SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005008 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005008
Domain Number 1 Region: 232-340
Classification Level Classification E-value
Superfamily TPR-like 2.9e-28
Family Tetratricopeptide repeat (TPR) 0.00053
Further Details:      
 
Domain Number 2 Region: 1937-1981
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000518
Family RING finger domain, C3HC4 0.036
Further Details:      
 
Domain Number 3 Region: 489-604
Classification Level Classification E-value
Superfamily TPR-like 0.000000311
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005008
Domain Number - Region: 830-897
Classification Level Classification E-value
Superfamily DEATH domain 0.0112
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005008   Gene: ENSMLUG00000005476   Transcript: ENSMLUT00000005488
Sequence length 1990
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430151:530585:622726:1 gene:ENSMLUG00000005476 transcript:ENSMLUT00000005488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDILALGEYTTTDYAWLEESPFEDDSVFASEFMPNDYVRVTQLFCDGVGRQYKDYAESER
NLEFDICNMWCTKPVSILRDYCDAIKIHIFWPLLFQHQHSSIISRLYPCVEATTSHTSEI
SLKELQHLELMEDIVDLAKKVMNDSFFIGGLLRIGYKIENNILAMEEALNWVKYTGDVTI
LSKLGEVDNCWPLLSIFFTEYKYHITKVVTENCNILDEFKRQTCAECIQQGELMKMKGNE
EFSKERFDLAIIYYSRAIEYSPENYHLYGNRALCFLRTGQFRHALGDGKRAIILKNNWTK
GHYRYCAALYMLGEYEWALQANSKAQKLCKNDPEGINDLIQQHVKLQQQIEDLQGGTSTR
NPIKAFYESGAYTPSLPAPAFSTSLNFVEIERDSSKTYHEMAYDGNQHLMVLDEALTIDD
CACHPEFLPLSGQPPKYKGKQKSRNNELEFSSYGSQGSFPADLKSLLEKQFSKSSRAAHQ
DFANIMKMLRSLIQDGYTALLEQRCRSAAQSFSELLNGLDPQKVKQLNLAMINYVLVVYG
LAISLLGIGQPEELSEAENQFKRMIEHYPNEGLDCLAYCGIGKVYLKKNRFLEALNHFEK
ARTLICRLPGVLTWPTSNVVIEETRPGKIKMLLEKFIEECRFPPVPDAVCCYQKCHGYSK
IQIYITDPDFKGFIRISCCQYCKIEFHMNCWKKLKTTTFNDKIDKDFLQGICLTPDCEGI
ISKIIIFSSGGQVKCEFEHKVVKEKKVPSKPILKQKCSSLEKLRLKEDKKLKRKIQKQEA
KKLAQERMEEDLRESNPPKTEEQKETVASAESCQFLDDRILQCIKQYADKIKSGVLNAST
LLKELLSWKVLSTEDYTTCFSSRNFLSEAVDYVIRHLVQEKNRVKTRIFLHVLSELKEVE
PKLATWIQKLNSFGLDATESFFSRYGASLKELDFSIMTFLWNEKYGHKLNSIEGKQLDYF
CESASLKEARCLIWLLEEHRDKFPALHNALDEFFDIMDSRCTVLRKQDSGDVPFNSTKIK
NKGKKKKPKDLKPMLVGSGTTSVTPNNETIASGEDHNNRRNSNSAGPFVVPDHLRQDVAE
FEALYGQHSNEYVVRKKKLWDINPKQKNSTLYDYFSQLLEEHGPLDMSNKMFSEEYEFFP
EETRQILEKAGGLKSFLLGCPRFVVIDNCIALKKVASRLKKKRKKKNIKTKVEEMSKTGE
YLRVKLPLNPTAREFKPDVKSKAVSSLSSAPASEGAKPRPASADFPKPACETEKPQPVSK
PQPVSVSEGEKSKEVAPSPPKAASEDASRHPQPVHEDVKTTYWTQAHVVTGYCTYLPFRA
FELAPPPPAYISMVPTLPQYTNIYTPLATISTEYQLQTSVTVVSSYVANDRPDQSAAVYF
DGRRLNAEHAPGNQIASETQILQDSLQISVKSQYSTGGADPAQSEPSRNNGHCGNSAHKQ
EANPERTDEATNIPHTQVVAIQVSGNVAHREVNTEPYDPFEAQQGDISQIEKESQVLQEQ
LEEACENYEQRKLKASEETRDLEEKLKRNLEENKISKTELDWFLEDLQKEIKKWQQEKKE
IQERLTALKKEMKRVSDATETYTQKNDGQEKEHEFLLDQSSEISNTFTNEKTKIEEQIRK
GKEQYEEILQRAVAAEVSVLENRREAEVYKLQIVESQAEGYLKTLKQLRSDSAAYPELES
DIHSWESFLSDVRKEIEKAESQFEEQIKAIKTGSRLSELPEVQISALPFPAWSTIRPESL
PESPGHDEQGPSTSASHGTGNPTAGPRDSSLVSAGDRPVGAPSPSLPASPSAQQECEGTS
QAAQPKRSLPADQKLPVPPGRARASQSPKRPFNSILEHLSAVLPCYSSTELAGFIRKVRN
KSKTSLSGLSIDEIVQRVMAHILEEQQSQKPRPGQGRPLSEPSSAASGMGATQGPPSVIA
GPSPKARGQRTEDAPTLGAHSCEICHEVFKSKNVRALSCGHKFHKGCFKQCLKGQSTCPA
CLDRDLPSGE
Download sequence
Identical sequences G1P4V8
ENSMLUP00000005008 ENSMLUP00000005008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]