SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005038 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005038
Domain Number 1 Region: 384-486,517-762
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.44e-111
Family Oxysterol-binding protein 0.00004
Further Details:      
 
Domain Number 2 Region: 81-192
Classification Level Classification E-value
Superfamily PH domain-like 2.63e-21
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005038   Gene: ENSMLUG00000005512   Transcript: ENSMLUT00000005518
Sequence length 767
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429872:1268966:1346493:1 gene:ENSMLUG00000005512 transcript:ENSMLUT00000005518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGVKMQGVDPVSTMKVSESEGKLEGPAPAPAVTPNKNSSNSSGGGGISSSSSGSSSGG
GGGGRGGNAKSWQYSDHMENVCGYLMKYTNLVTGWQYRFFVLNNEAGLLEYFVNEQSRNQ
KPRGTLQLAGAVISPSDEDSHTFTVNAASGEQYKLRATDAKERQHWVSRLQICTQHHTEA
IGKNNPPLKSRSFSLASSGNSPISQRRPSQNAISFFNVGHSKLQSMSKRAHLPPDHLVEV
REMMSHAEGQQRDLIRRIECLPASGHLSSLDQDLLMLKATSMATMNCLNDCFHILQLQHA
SHQKGSLPPGTTIEWLEPKIPLSNHYKNGADQPFAAEQSKPMAVPEEQCVAESGLLAREP
EEINTDDEVEDTCDNKEDDLGAVEEQRSVILHLLSQLKLGMDLTRVVLPTFILEKRSLLE
MYADFMSHPDLFIAISNGATAEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCS
WKMPKSEVASSVTSNSSTQAVTNHAPLSEEALSQVGPDCYTVRFVAEQVSHHPPVSGFYA
ECAERKMCVNAHVWTKSKFLGMSIGVTMVGEGILCLLEHGEEYTFSLPCAYARSILTVPW
VELGGKVSVNCAKTGYSASITFHTKPFYGGKLHRVTGEVKHNGSNTVVCKVQGEWNSVLE
FTYSNGETKNVDLTKLAVTKKRVRPLEQQDPFESRRLWKNVTDSLRESEIDKATEHKRTL
EERQRAEERHRIETGTPWKTKYFIKEGDGWVYHKPLWKIIPTTQPAE
Download sequence
Identical sequences G1P4Y2
ENSMLUP00000005038 ENSMLUP00000005038 XP_006092899.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]