SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005049 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005049
Domain Number 1 Region: 633-863
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 3.01e-94
Family Rap/Ran-GAP 0.00000154
Further Details:      
 
Domain Number 2 Region: 480-629
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 6.28e-17
Family Rap/Ran-GAP 0.0037
Further Details:      
 
Domain Number 3 Region: 992-1066
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000133
Family PDZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005049
Domain Number - Region: 1753-1801
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005049   Gene: ENSMLUG00000005530   Transcript: ENSMLUT00000005533
Sequence length 1822
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429974:307543:433981:1 gene:ENSMLUG00000005530 transcript:ENSMLUT00000005533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLKRSQTERPIATDRASVVGTDGPPKVHTDDFYMRRFRSQNGSLGSSVMAPVGPPRSE
GPHHITSTPGVPKMGVRARIADWPPRKENVKESSRSSQEIETSSCLESMSSKSSPVSQGS
SVSLNSSDSAMLKSIQNTLKSKTRPLESMDSRFLMPEAYPSSPRKALRRIRQRSNSDITI
SELDVDSFDECISPTYKTGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDDKSDRGPTP
TKLSDFLIAGGGKGSGFSLDVIDGPITQRDNLRLFKEREKPLKRRSKSETGDSSIFRKLR
NAKGDELGKSSDLEDNRSEDSVRPWTCPKCFAHYDVQSILFDLNEAIMNRHNVIKRRNTT
TGASAAAVASLVSGPLSHSASFNSPMGSTEDLNSKGSLGMDQGDDKSNELVMSCPYFRNE
IGGEGERKISLSKSNSGSFSGCESASFESALSSHCTNAGVAVLEVPKENLVLHLDRVKRY
IVEHVDLGAYYYRKFFYQKEHWNYFGADENLGPVAVSIRREKPEEMKENGSPYNYRIIFR
TSELMTLRGSVLEDAIPSTAKHSTARGLPLKEVLEHVIPELNIQCLRLAFNTPKVTEQLM
KLDEQGQSFKKHLYLIYSVRGEFDNDKMITCPKRTEQSLKINSEGLNYQQKVGIMYCKAG
QSTEEEMYNNESAGPAFEEFLQLLGERVRLKGFEKYRAQLDTKTDSTGTHSLYTTYKDYE
IMFHVSTMLPYTPNNKQQLLRKRHIGNDIVTIVFQEPGAQPFSPKNIRSHFQHVFVIVRV
HNPCTDSVCYSVAVTRSRDVPSFGPPIPKGVTFPKSNVFRDFLLAKVINAENAAHKSEKF
RAMATRTRQEYLKDLAEKNVTNTPIDPSGKFPFISLASKKKEKSKPYPGAELSSMGAIVW
AIRAKDYTNAMEIDCLLGVSNEFIVLIEQETKSVVFNCSCRDVIGWTSTDTSLKIFYERG
ECVSVESFTNNEDIKEIVRRLQFVSKGCESVEMTLRRNGLGQLGFHVNYEGIVADVEPYG
YAWQAGLRQGSRLVEICKVAVATLSHEQMIDLLRTSVTVKVVIIPPHDDCTPRRSCSETY
RMPVMEYKMNEGVSYEFKFPFRNNNKWQRNASKGPHGPQVPAQVQSPMTSRLNAGKGDGK
MPPPERAANIPRSISSDGRPLERRLSPGSDIYVTVSSMALARSQQCRNSPSNLSSSSETG
SGGGTYRQKSMPEGFGVSRRSPASIDRQNTQADLGGSGKSTPSWQRSEDSIADQMEPTCH
LPAVSKVLPTFRESPSGRLMRQDPVVHLSPNKQGHPDSHYSSHSSSNTLSSNASSAHSDE
KWYDGDRTESELNSYNYLQGTSADSGIDTTSYGPSHGSSASLGAATASPRSGPGKEKVAP
LWHSSSEVISMVDRTLEAESHGLDRKAESSLSLDIHSKSQAGSSPLTRESSTFSINDAAS
HTSTMSSRHSASPVVFTSARSSPKEELHPATSSQLAPSFSSSSSSSSGPRTFYPRQGATS
KYLIGWKKPEGTINSVGFMDTRNRGSQAGNIFRFESLRSPRKQIRASPKPASKSTIEEDL
KKLIDLESPTPESQKNFKFHALSSPQSPFPHTPTSRRALHRTLSDESIYSSQREHFFTSR
ASLLDQALPNDVLFSSTYPSLPKSLPLRRPSYTLGMKSLHGEFSASDSSLTDVQEARRPM
PDPGLMPLPDAAADLDWSNLVDAAKAYEVQRASFFAASDENHRPLSAASNSDQLEDQALV
QMKSYSSSKDSSPTLASKVDQLEGMLKMLREDLKKEKEDKAHLQAEVQHLREDNLRLQEE
SQNASDKLKKFTEWVFNTIDMS
Download sequence
Identical sequences G1P4Z2
ENSMLUP00000005049 ENSMLUP00000005049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]