SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005075 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005075
Domain Number 1 Region: 169-514,593-617
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.06e-84
Family Myotubularin-like phosphatases 0.0000458
Further Details:      
 
Domain Number 2 Region: 16-96
Classification Level Classification E-value
Superfamily PH domain-like 0.0000738
Family GRAM domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005075   Gene: ENSMLUG00000005552   Transcript: ENSMLUT00000005559
Sequence length 716
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430201:618248:649651:-1 gene:ENSMLUG00000005552 transcript:ENSMLUT00000005559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIHTNEKEVAEKEVTLHLLPGEQLLCEASTVLKCVQEDSCQRGIYGKLVCTDFKIAFLGD
DESALESDETQFKNKIIGENDITLHCVDQIYGGRPKGQKWKFKALRKPDRMVSLCLFDRE
LLGQWGEKEIKLIVSGIIHHTLAPKRLKRLFLFSYATAVHSNTPTNPQNHTVMFDTLEDW
CWELERTKGSMKYKAVSVNEGYKVCERLPAYFVVPAPLPEESVSRFQGHGIPIWCWSYHN
GCALLKMSALPKEQDDGILQTHKNFLDGIYRVIHRPPYEIVKTEDLSSNFLSLPDIQTAY
SKFKQLFLIDNSTEFWDTDIKWFSLLESSSWLDIIRRCLKKAIEVIECLDAQNTNVLLVE
ENASDLCCLVSSLVQVMMDPHCRTRAGFQSLVQKEWIAGGHCFLDRCNHLRQSDKEEVPV
FLLFLDCVWQLVHQHPPAFEFTETYLTVLSDSLYIPIFSTFFFNSPHQKEMNLGREGQDA
HSTPLHLLTVWDWSVQFESRAQALLQNPLYVEKPKLDKGQRKGTHLKHQRQLSLPLTQSK
SSPKRGFFREETDHLIKNLLGKRISKLINYSDELQDSFREFYDSWHSKPADYHGLLLPHI
EGPEIRVWAQRYLRWIPEAQILGGGAVAMTSRLVGMMEEVRSLQEKINERHHHQTALPAE
APSLLRSSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEEDLARREDEFVDLGEV
Download sequence
Identical sequences G1P514
ENSMLUP00000005075 ENSMLUP00000005075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]