SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005100 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005100
Domain Number 1 Region: 12-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-50
Family BAR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005100   Gene: ENSMLUG00000005585   Transcript: ENSMLUT00000005584
Sequence length 250
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430095:495078:512684:-1 gene:ENSMLUG00000005585 transcript:ENSMLUT00000005584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRKLQKDLKKSTDADLAMSKSAVKIS
LDLLSNPLCEQDQDFMNMVTALDTAMKRMDAFNQEKVNQIQKTVVEPLKKFGSVFPSLNM
AVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVRDDFEAKNKQLLDEM
PRFYNSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLTQQLDQPGHPDEQRERENEAKLSE
LRALSIVADD
Download sequence
Identical sequences G1P536
ENSMLUP00000005100 ENSMLUP00000005100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]