SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005117 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005117
Domain Number 1 Region: 706-922
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-60
Family DBL homology domain (DH-domain) 0.0000000526
Further Details:      
 
Domain Number 2 Region: 908-1061
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-45
Family Pleckstrin-homology domain (PH domain) 0.00000165
Further Details:      
 
Domain Number 3 Region: 606-732
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-24
Family SH3-domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005117   Gene: ENSMLUG00000005602   Transcript: ENSMLUT00000005601
Sequence length 1129
Comment pep:novel scaffold:Myoluc2.0:GL429865:1801325:1884732:1 gene:ENSMLUG00000005602 transcript:ENSMLUT00000005601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFKKLKSSVFQGIQNREGSDAAKEEASEPDAGPALPNGAAVAIPAGGPPQPGPVSDGS
DPEEADDAFQRSTHRSRSLRRAYGWPHQPPGRGAGAAGPARVPGPTGAPVCAILVKDSEI
NSVAYRRSKSTDNLSFLRKSSFKRKSASNLADLRTAPDRPAPRRTLSSCSADSEKLGGSE
RRTKRWKSPIRAKDFDRVLRLVSSATDAAWKRERPKGEAPGPGDAAPRPGPRSRLHDDYS
RRASSGAEPESRRAGPGPDFSPAGPRGPHVDVETAVFPLEAQSGGPCTGSALPSPPAQEA
ARKDSLEPKPGSQFTWEPEQPTPLRPTAPKPPSPQSPSGKDPNNLSALSLSSVDSNERGE
GPVPFPDLVPATCDNGSEDSGSRSHPQLSLSEASGPEEKEEEIVFTEETWRRGSSLEEDG
KEAQRIPRRRWGSGRRSRPRPLSDYGQFACRSLSIPEDSIAVDPQKEDIVDSDHQLSMAS
TDPAGQNAATGCPKGCQRRRPISVIGGVSFYGNRQTEAIETLLTQPAARPPVPAHQVPPY
KAVSARFRPFTFSQSTPIGLDRVGRRRQMRASNISSDGGTESCALVDDNGSEEDYSYEDL
CQANPRYLQPGGEQLAINELISDGSVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKD
WWWGRSEEKEAWFPASFVRLRVNQEELSENSSSTQGEEQQEDAGTTRHKHSESKQQMRTN
VIQEIMNTERVYIKHLKDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFLKDL
EKQYNKDEPHLSEIGSCFLQHQEGFAIYSEYCNNHPGACTELSGLMKQSRYRHFFEACRL
LQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHSDYNNIKAAYEAMKNVACLINE
RKRKLESIDKIARWQVSIVDWEGRDILDRSSELIHSGELTRITKQGKSQQRTFFLFDHQL
VSCKKDLLRRDMLYYRGRMDMDDMELVDLEDGRDKDWNLSVKNAFKLVSKTTDEAHLFCA
KKQEDKARWLQACADERRRVQEDREMGMEISENQKKLAMLNAQKAGHGKSKGYNGCPVAP
PHQSLHPMHQRHVTVPTSVPQQQVFALAEPKRKPSLFWHTFNKLTPFKK
Download sequence
Identical sequences G1P550
ENSMLUP00000005117 ENSMLUP00000005117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]