SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005126 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005126
Domain Number 1 Region: 92-205
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 2 Region: 247-348
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000139
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005126
Domain Number - Region: 562-616
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0259
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005126   Gene: ENSMLUG00000005612   Transcript: ENSMLUT00000005612
Sequence length 619
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430419:301466:316778:-1 gene:ENSMLUG00000005612 transcript:ENSMLUT00000005612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKSWISEDDFYRPPQEQPPESPSDGSAASPRGTPESRPCLLRHFSQGPRKSSSMGALDK
ACVPSPGSRKSPAAATQEHKNFRVVHRRQMGLSNPFRGLMKLGTVERRGAMGIWKELFCE
LSPLEFRLYLSGEERTCVENCSLLRCESVGPAHSDGRFELVFSGKKLTLRASSQDEAEDW
LDRVREALQKCRPQQEEEWVSVQYPEQPSDLPKDPQGGPPSHSEPTEPESLQGTQLDWSS
VQVPEPDAIKESLLYLYTDRTWTPYIFSLSLDSLKCFRVKNNEKMLSDSHGVETIRDILP
DTSLGGPSFFKIITAKAILKLQAGSAEEAALWRDLVRKVLASYLETAEEAVTLGGSLDEN
CQEVLKFATGEQGFLLQYLVAIPTEKGLDSQGCFCAGCSRQIGFSFVRPKLCAFSGLYYC
DICHQDDASVIPARIIHNWDLTKRPVCRQALKFLMKIRAQPLINLQLVNPSLYEHEERMH
LIGRSREQLKLLGDYLGLCRSGALKELSKRLTHRNYLLESPHKYSVADLQQISEGVYEGF
LKTLIEFASQHVYHCDLCTQRGFICQICHHHDIIFPFEFDTTVRCGECKTVFHQSCQAVV
TGCPRCARRRKYHEQNALT
Download sequence
Identical sequences G1P558
ENSMLUP00000005126 ENSMLUP00000005126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]