SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005129 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000005129
Domain Number - Region: 107-180
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0013
Family HtrA-like serine proteases 0.076
Further Details:      
 
Domain Number - Region: 10-47
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00457
Family HtrA-like serine proteases 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005129   Gene: ENSMLUG00000005614   Transcript: ENSMLUT00000005615
Sequence length 431
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430050:950289:958311:1 gene:ENSMLUG00000005614 transcript:ENSMLUT00000005615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGSSTEQPAETSEGFHLHGVQDNSPAQQAGLEPYFDFIITIGHSRLVRPSSCLPFLLP
AQRSAPELSGMDWSFLFREVGLPPTGGWWCRRGRLDVAVRVQHSYTCTLHIVVLIDVEPS
SPASLAGLCPYTDYVIGSDQLLQESEDFFTLIESHEGKPLKLMVYNSESDSCREVSVTPN
AAWGGEGSLGCGIGYGYLHRIPIQPPSYHKKPPPGALPPGTLPSGTPPPGALPPGTTPLD
SPAPPGPEMGSRQGDYLEATPMRPNARPLSFLGNKQLGGGEPLGCQRAVPLPLGFLDVSG
ISLLDSSASVCPSLPSFPELTSTAVPAAGLEDVGSSSGSHERGGEATWSGSEFEVSFPDS
PGAQAQQDHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTASPGLRAEAEAASQA
QLATPEQHPGQ
Download sequence
Identical sequences G1P560
ENSMLUP00000005129 ENSMLUP00000005129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]