SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005172 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005172
Domain Number 1 Region: 5-113
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-26
Family Phosphotyrosine-binding domain (PTB) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005172   Gene: ENSMLUG00000005662   Transcript: ENSMLUT00000005662
Sequence length 668
Comment pep:novel scaffold:Myoluc2.0:GL430274:609950:655448:-1 gene:ENSMLUG00000005662 transcript:ENSMLUT00000005662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQYEFKAKNIKKKKVSIMVSVAGVKVILKKKRQKKEWTWDETKMLVMQDPIYRIFYVSHD
SQDLKIFSYIARDGASNVFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQSADG
QEDGDSEWHSHSSGDPGRQLPGAERASPATAEETDIDAVEVPLPGSDGLDFSRGVTDLDA
VRKDGASHTDSKVPPQEPVPTASPQMPLPPPCAQAPGVGTPLSSQHQLQLLHQLLQQQQQ
QTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNRDALQHVSLLVRQVQELELKLSG
RSTMGSQDSLLEITFRPGALPVLCDPTTPTPEDLPSPPLGAGPALPAGSPLGRRDCLVKL
ECFRLPGARGPPLGGLELLRFRESGIASEYESTTDESEEEPPRLLHVRQRREPGDSLEDT
VAVYVENLNTSLPTESRRPATLGPRHPGRGPLGPVEPGGPGLWVGSSQHLRNLGKAMGAK
VNDFLRRREPWGLGSVGAMEVNRTAEAQLAGAPGGEDDGPALPEAVPLLDPPPPTTRKRT
PRALKTTQDMLISAQPVLSSLECSPPPAQPGPAGAPPPEATVDVALPNGEASLSVPDLIH
PDGSGEPRLKGAQCRRVSPPDPTESSGLQPSLSPGHPAELPQDSSPCPGARTCSLDSEGP
HPDLLSFE
Download sequence
Identical sequences G1P597
ENSMLUP00000005172 ENSMLUP00000005172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]