SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005264 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005264
Domain Number 1 Region: 143-232
Classification Level Classification E-value
Superfamily HMG-box 4.45e-22
Family HMG-box 0.0024
Further Details:      
 
Domain Number 2 Region: 46-137
Classification Level Classification E-value
Superfamily HMG-box 1.83e-20
Family HMG-box 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005264   Gene: ENSMLUG00000005759   Transcript: ENSMLUT00000005760
Sequence length 245
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430020:1504857:1517513:1 gene:ENSMLUG00000005759 transcript:ENSMLUT00000005760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLRGVWGVLSALGKSGAELCADCGTRLCAPFRFVYIPRWFSSTLSSYPKKPMTSYVRF
SKEQLAIYKARNPEAKNSELIKKIAEIWRELPESEKKIYEDAYKADWQAYKEELNRIQEQ
LTPSQKVSLEKEMMQKRLKKKSILKKRELTLLGKPKRPRSAYNIFISECFQGAKNGSSQV
RLKSIHESWKNLSSAEKQVYIQLAEDDKARYYSEIKSWEEQMVEVGREDLLRRKVKPQSK
STEKY
Download sequence
Identical sequences G1P5H6
XP_006098959.1.53796 ENSMLUP00000005264 ENSMLUP00000005264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]