SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005321 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005321
Domain Number 1 Region: 13-240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.84e-66
Family BAR domain 0.000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005321   Gene: ENSMLUG00000005824   Transcript: ENSMLUT00000005823
Sequence length 288
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430450:210952:232430:1 gene:ENSMLUG00000005824 transcript:ENSMLUT00000005823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSICPLMVSEHHILQLIREKINGIEGTKLDDHFLDLEKKIDITNKAVTEILLKTTEYIQP
NPAYRMKLGLLSPMLKIHNWGKAPGCLQPEGLLGNCMLKYGQELGEDSTFGSALTDMGEA
MKLMAEVKESFDINVKETFIDPLQLVQDEDLKQISNHLKRLEGRRLDYDYKRRHVGKIPD
NEITQAMEKFEESKAIAERCMFNFLENDVEQVGQLALFIQAALEYHQQSVNILQPLQRKL
RMRIAAASSLGRNDFMLQPLRRCPKSLNLSTTSSAKSIGEMPALGPGA
Download sequence
Identical sequences G1P5M3
ENSMLUP00000005321 ENSMLUP00000005321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]