SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005329 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005329
Domain Number 1 Region: 47-138
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-27
Family PDZ domain 0.00015
Further Details:      
 
Domain Number 2 Region: 188-276
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-25
Family PDZ domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005329   Gene: ENSMLUG00000005825   Transcript: ENSMLUT00000005832
Sequence length 381
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430099:562381:571253:1 gene:ENSMLUG00000005825 transcript:ENSMLUT00000005832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTGGAEANTRSPAPPSPPSRPRPWLAGGGCERRGQPLARGWVASAMATPEPLRPRLCCLV
RGEHGYGFHLHGEKGRRGQFIRRVEPGSPAEAAELRAGDRLVEVNGVNVEGETHHQVVQR
IKAVEGQTRLLVVDKETDEELRRRQLTCTEEMAQRGPPAHDPWEPKPVWTRAGSLAQVSG
PGDVNGPPRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDVGSPAAHSGLRAQDRL
IEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPV
TNGTSPAQLNGGSACSSRSDLPGLDKDNEDRSTWKHDPFQESGLHLSPTAAEAKEKAKAT
RVNKRAPQMDWNQKREIFSNF
Download sequence
Identical sequences G1P5N0
ENSMLUP00000005329 ENSMLUP00000005329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]