SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005342 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005342
Domain Number 1 Region: 262-391
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 393-498
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-23
Family Third domain of FERM 0.0071
Further Details:      
 
Domain Number 3 Region: 31-133
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-18
Family PDZ domain 0.035
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000485
Family Ras-binding domain, RBD 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005342   Gene: ENSMLUG00000005822   Transcript: ENSMLUT00000005845
Sequence length 1548
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430239:9774:48464:-1 gene:ENSMLUG00000005822 transcript:ENSMLUT00000005845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELETRKAHRIEQMVARWLRRSRDSSARAKVTAADGSPGIPTQTLIPVKHTVKVDKDAL
LQDYGFHISESLPLTVVAVTPGGCAHGKLFPGDQILQVNNEPAEDLSYERAVDILREAED
SLSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLVSAHSQGNSLLCMPNVLKL
YLENGQTKAFKFEADTTVKDIILTVKEKLSIRCTEYFALVLEEQYNVSRLHLLHEEELIQ
QVVEKEELQDYRCLFRVCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEMKCSSA
LRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISFHMKRN
QNLLEPRQKQLISAAQLRLNYLQILGELKTYGGKIFNATLMLQDRESYVALLVGAKYGIS
QIINSKLNIMSTLAEFANISRVELTEESEKVSVVKVYLQDIKVLTLLLESNSAKDLACLV
AGYYRLFVDPVTSIFLWPGNKQQVHRVSAEEGYESRACSDSEESSEVDCVLEPLSDQHLP
RPGPCRSPAKEEQPPGDSPTPEVAGRGPSACGASSVTDSAESEASDSANTESRGCRTSGS
SESMDALEEDDLDACSSSRSGFFHFGFPERGESDSQEERSRIETSGFLCLLDLAQRASPQ
PQKTELSESPAPGTFGWAPDPSAARLDPGLYEGSQTDYYSLCSSVSPARHLSDSSDSTAS
RQGGGPPAWGQQGWSEAQPSSTLEALGPACEEGSSDEEYYDAADKLTPPDTLSGPGAISA
AEPSATRTQSEASSCSPEDGLRTGPDGREARRRGGVKKYAKTLRKRRSFLQTDYTCQVSF
PLVPSASLENMDDVCYYDREPYLALGAPSPTVSSLQDVQGEPGLLETKALGLLAPLREAK
SKNPAARVMEMEPETMETKSVIDSRVSSISAIRLRIDPGPKENSGGAPVPATVASCPAST
PNCPNPGSSGPDTAQTESSQTLSAFQDSDGSAPEELSMELEGSTSPLSSAEPNTGSVCLA
ISQGPPTVSPGDTLELGGVLLEAGLGSLFTNPTQETAPQNTEPLLPLGDRPGSGECGINS
GEKAAPFPIKEEQQGQLSLDRDGGVTNKNVTNLCHDEPGKDPGDPEGDVSSAVPQTTGVG
APDGGIAASPSLETPVTGTDPTPAHSPAERQGQRRETPSHACQNQTIPSASPLEEGKAEP
LNHVTGEDTGPRDTPQQVCFTPRPSPLHPLPCPQGEPHSEGSTQCSLSESRDKTPSICLP
AEKSFLCFSPESHPKVSASLRMATSLGFAGVNETVAPGIGMEQCSCQLSYATCFRGLQPE
TEEEDRDSEAPPTAPLTSPPSAGSGLALPWRPARAHSCSAEPLLRNSHIWPEYCSRALTR
LKAAPASTPEGFIRLSESLLELQDILEASWGNGDKHPPEKCTWHFSESRSHLCMGSQKLL
SSCQHVIRMDQSPEEMQGAVRDTFQYLVQLAGLCFQFTDCSRCSARHREAAGNLRDVVYT
YHQFVEAAKLTCERGYHDLSVKLLAHQCTALTAAVFCLTQKFRASTAL
Download sequence
Identical sequences G1P5P1
ENSMLUP00000005342 ENSMLUP00000005342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]