SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005428 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005428
Domain Number 1 Region: 127-176
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000536
Family Elafin-like 0.00038
Further Details:      
 
Domain Number 2 Region: 28-71
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000249
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005428   Gene: ENSMLUG00000005941   Transcript: ENSMLUT00000005940
Sequence length 178
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429857:3557014:3560340:-1 gene:ENSMLUG00000005941 transcript:ENSMLUT00000005940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTCRYGLLAALFLGLLLSFAAATGTGAGKAGVCPELKEELNCTQECGSDGECADNLKCC
RAGCAAVCLLPNVKRPPPLQGWGERMRERGCSMETAGRLGIQRPSLFQRSTWPHLLSQPR
DGVGQWEEEKPGSCPKVDLPLTPLGLCRDQCQVDSECPDQMKCCLNGCGKVSCVTPVF
Download sequence
Identical sequences G1P5X0
ENSMLUP00000005428 ENSMLUP00000005428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]