SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005429 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005429
Domain Number 1 Region: 96-204
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.33e-23
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000135
Further Details:      
 
Domain Number 2 Region: 198-314
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.44e-22
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000273
Further Details:      
 
Domain Number 3 Region: 43-94
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000664
Family TS-N domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005429   Gene: ENSMLUG00000005940   Transcript: ENSMLUT00000005941
Sequence length 322
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429886:1916949:1927195:-1 gene:ENSMLUG00000005940 transcript:ENSMLUT00000005941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRLCLVARTGSCPPLPLQSPQPWHTFHAGHWLSSASSKDLLMKLRRKTGYSFVN
CKKALETCGGDLRQAESWLHEQAQKEGWGKAAKLHGRKTKEGLIGLLQEGNSTVLVEVNC
ETDFVARNLKFQQLVQQVALGTMLHCQSLKDQLSTYSKGFLNSSELSELPFGPERKGSLK
DQLALAIGKLGENMTLKRAAWVKVPNGFYVGSYVHGTMHSPSLHNLVLGKYGALVICEIS
EWKANLEELGRRLGQHVVGMAPLSVGSLDDEPGGETETKMLSQPYLLDPSITLGQYVQPQ
GVSVVDFVRFECGEEGEAAEAE
Download sequence
Identical sequences G1P5X1
ENSMLUP00000005429 ENSMLUP00000005429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]