SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005433 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005433
Domain Number 1 Region: 65-130
Classification Level Classification E-value
Superfamily BPTI-like 1.39e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 2 Region: 29-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000000366
Family Elafin-like 0.0022
Further Details:      
 
Domain Number 3 Region: 129-171
Classification Level Classification E-value
Superfamily Elafin-like 0.0000536
Family Elafin-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005433   Gene: ENSMLUG00000005945   Transcript: ENSMLUT00000005945
Sequence length 179
Comment pep:novel scaffold:Myoluc2.0:GL429857:3519910:3533436:1 gene:ENSMLUG00000005945 transcript:ENSMLUT00000005945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSGLLRILVISILLENVQGFSLTNLFSPRRCPRIREKCQFKERDECSKNKTCPDKKKC
CVFNCGKKCLDLQQDICSLPKNPGPCMAFFRRWWYDKKNDTCSTFIYGGCQGNNNNFQTK
DLCQNMCSKKHTCPKIKVHCDTNEINQCLKSRQCPEKMKCCNFNCARKCLNLKQGNSEI
Download sequence
Identical sequences G1P5X5
ENSMLUP00000005433 ENSMLUP00000005433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]