SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005435 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005435
Domain Number 1 Region: 172-302
Classification Level Classification E-value
Superfamily GAT-like domain 6.28e-48
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.000000227
Further Details:      
 
Domain Number 2 Region: 42-167
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.6e-44
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.000000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005435   Gene: ENSMLUG00000005936   Transcript: ENSMLUT00000005948
Sequence length 678
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429873:3215853:3310445:1 gene:ENSMLUG00000005936 transcript:ENSMLUT00000005948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGPGPRRLRKGRGGGGAAEMSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKH
LDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRN
TLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNT
EKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEK
YFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
LASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQ
RLKELAKKPHTSLTTAASPVSTSAGGIMTVPVIDLFSTPSSSNSSSKLPNDLLDLQQPTF
HPPGLSMSASSQVASTWGDPFSATVDAVDDAIPNLNPFITSSGDVYLPIPADVPTFTTRT
PTHEMFVGFTSSPGAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQN
QSLPVSKLPPNKLVSDDLDSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKV
APTTAWNAATVNGMHFPQYAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIYNQPV
MRPPNPFGPVSGAQVLIN
Download sequence
Identical sequences G1P5X7
ENSMLUP00000005435 ENSMLUP00000005435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]