SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005437 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005437
Domain Number 1 Region: 73-136
Classification Level Classification E-value
Superfamily BPTI-like 5.96e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 2 Region: 32-80
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000589
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 3 Region: 139-184
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000262
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 4 Region: 184-229
Classification Level Classification E-value
Superfamily Elafin-like 0.0000017
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005437   Gene: ENSMLUG00000005950   Transcript: ENSMLUT00000005950
Sequence length 231
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429857:3505929:3513125:1 gene:ENSMLUG00000005950 transcript:ENSMLUT00000005950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPRHTATVSRRSRALLLLLSLSLELTFAAPRQRIRRKPGTCPKERLKCQTKIKNSCAEDF
GCEEHLKCCQFACGKKCMDPYEEPCMLSLDQGNCDRFDRRWYYDLKNLLCKPFKYGGCDG
NSNNFLSKEDCMKACSLTVKKGQCPLFPSKNRMECSGSCKSDNDCADKEKCCESMCGFVC
SVAWKVKTGSCPQKPPTCLRIDKPKCQRDEDCQLGEKCCSRCGLKCLEPRA
Download sequence
Identical sequences G1P5X8
ENSMLUP00000005437 ENSMLUP00000005437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]