SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005451 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005451
Domain Number 1 Region: 20-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000014
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 2 Region: 123-204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000729
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005451   Gene: ENSMLUG00000005966   Transcript: ENSMLUT00000005966
Sequence length 333
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429957:2180802:2188045:1 gene:ENSMLUG00000005966 transcript:ENSMLUT00000005966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFILWFSVSAGPAASGAQQELVGAVGGSVTFPLTHSVDRIDSIIWIFKSTTLITIQPTT
TNKPDTVIVTKNHDKGRVGFLHGNYSLKLSKLSKNDSGAYSVQIHSSSLQEPFTQEYGLR
VYEHLSKPKITLGLKSNKNGTCVTNLTCFLERGGEDVTYSWKTLGKTSNESHNGSVLPIT
WTLREKDMTFICMARNPISSNSSNLIFARKLCEGIAGDLDSTMGLWISSLLIVLVLVLII
LTMWKQSLGSNEGNQKSTEEKKMDTHPEIPNCYPPSGETAEYDTISNPNKTIPEENSEHP
LYCTVQIPQKMEKPHSLPTSPDTPKLFIYEKVI
Download sequence
Identical sequences G1P5Z1
ENSMLUP00000005451 ENSMLUP00000005451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]