SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005460 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005460
Domain Number 1 Region: 456-729
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-73
Family Protein kinases, catalytic subunit 0.0000464
Further Details:      
 
Domain Number 2 Region: 58-404
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.3e-67
Family Ankyrin repeat 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005460   Gene: ENSMLUG00000005964   Transcript: ENSMLUT00000005976
Sequence length 786
Comment pep:novel scaffold:Myoluc2.0:GL429792:1242969:1559661:1 gene:ENSMLUG00000005964 transcript:ENSMLUT00000005976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNYKSRPTQTCTDEWKKKVSESYVIIIERLEDDLRIKEKEFTELRHIFGSDDAFSKVNL
NYRTENGLSLLHLCCICGGNKSHIRTLMLKGLRPSRLTRNGFTALHLAVYKDSAELITSL
LHSGADIQQVGYGGLTALHIATIAGHLEAVDVLLQHGANVNVQDAVFFTPLHIAAYYGHE
QITRLLLKFGADVNVSGEVGDRPLHLAAAKGFFNIAKLLMEEGSKADVNAQDNEDHVPLH
FCSRFGHHDIVKFLLQSDSEVQPHVVNIYGDTPLHLACYNGKFEVAKEIIQISGTESLTK
ENIFSETAFHSACTYGKNIDLVKFLLDQNVVSINHQGRDGHTGLHSACYHGHIRLVQFLL
DNGADMNLVACDPSRSSGEKDEQTCLMWAYEKDEGHDAIVTLLKHYKRPQDELPCNEYSQ
PGGDGSYVSVPSPLGKIKSMTKEKADVLLLRAGLPSHFHLQLSEIEFHEIIGSGSFGKVY
KGRCRNKIVAIKRYRANTYCSKSDVDMFCREVSILCRLNHPCVIQFVGACLNDPSQFAIV
TQYISGGSLFSLLHEQKRILDLQSKLVIAVDVAKGMEYLHNLTQPIIHRDLNSHNILLYE
DGHAVVADFGESRFLQSLDEDNMTKQPGNLRWMAPEVFTQCTRYTIKADVFSYALCLWEL
LTGEIPFAHLKPAAAAADMAYHHIRPPIGYSIPKPISSLLMRGWNACPEGRPEFSEVVTK
LEECLCNIELMSPASSNSSGSLSPSSSSDCLVSKGGPGRSHVAALRSRFELEYALNARSY
AAWSQR
Download sequence
Identical sequences G1P5Z8
ENSMLUP00000005460 ENSMLUP00000005460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]