SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005470 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005470
Domain Number 1 Region: 561-672
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.32e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.0004
Further Details:      
 
Domain Number 2 Region: 14-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.42e-32
Family G proteins 0.00000274
Further Details:      
 
Domain Number 3 Region: 282-356,500-545
Classification Level Classification E-value
Superfamily PH domain-like 1.22e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 684-775
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000466
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005470   Gene: ENSMLUG00000005985   Transcript: ENSMLUT00000005988
Sequence length 806
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430103:400134:426446:-1 gene:ENSMLUG00000005985 transcript:ENSMLUT00000005988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVD
GQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMV
LVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVACGR
SSSWPSGPASHCPTPPSHSAVSAASIPSVHINQATNGGSSAFSDYSSSVPSTPSISQREL
RIETIAASSTPTPIRKQSKRRSNIFTSRKGADLDREKKAAECKVDSIGSGRAIPIKQGIL
LKRSGKSLNKEWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLPRA
TPATAPGTSPRANGLALDRSNTQLGGGTGEVAAGNGSKGAPHSASSPAWAGLRPEGLHQR
SCSVSSADQWSEAAALPPVVSAGRGMGDSPASGPAEVLSSSPKLEPPPSPHSNRKKHRRK
KSTGTPRPDGPSSAAEDVEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQ
GCRSAKDKTRLGNQNTALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGTHR
HLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALDGYAKPGPDACREEKERWI
RAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTA
LHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCG
LTPTPNREPANGTNTSAELHRSPSLL
Download sequence
Identical sequences G1P606
ENSMLUP00000005470 ENSMLUP00000005470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]