SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005525 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005525
Domain Number 1 Region: 289-407
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.5e-25
Family Regulator of G-protein signaling, RGS 0.0023
Further Details:      
 
Domain Number 2 Region: 500-633
Classification Level Classification E-value
Superfamily PX domain 7.46e-23
Family PX domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005525
Domain Number - Region: 242-274
Classification Level Classification E-value
Superfamily ISY1 domain-like 0.0262
Family ISY1 N-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005525   Gene: ENSMLUG00000006047   Transcript: ENSMLUT00000006050
Sequence length 848
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429869:3441816:3500713:-1 gene:ENSMLUG00000006047 transcript:ENSMLUT00000006050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLRLTFLIALFVLVVFDYSYRDYVLSWYGNLSKDEGQLYNLLLEDFWEIAKQLHHRLSHV
DVVKVVCNDVVRTLLTHFCDLKAANARQEEQPRPFVLHACLRNSAEEVRFLQTCSRVLVF
CLLPSKDVQSLSLRIMLAEILTTKVLKPMVAFLSNPDYINQMLLAQLERREHANEHHKRA
YTYAPSYEEFIKLINSNSDVEFLKQLRYQIVVEIIQATTISSFPQLKRQKGKETAAMKAD
LLRARNMKRYINQLTVAKKQCEKRIRMLGGPDYDQQEDGALEEAEGPQSQKILQFEDILA
NAFYREHFRMYMERMDKRALIGFWESVEYLKNANKNEIPQLVGEIYQNFFVESKEISVEK
SLYKEIQQCLVGNKGIEVFFKIQGDVYEVLKDRYYPSFIVSDLYEKMTMQEDETHASQLT
SNKDEAGLGDEAGEEAVDEGTSRINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDK
KIVSKLKEEIILTEKERTDLQLHLARTDWWCENLGMWKASITSGEVTEENGEQMPCYFVT
VSLQDVGGVETKSWTVPRRLSEFQNLHRKLSECFPSLKKVQLPSLSKLPFKSIDQKFMEK
SKKQLNKFLQNLLSDERLYQSEALYAFLSPSPDYLKAVDVQGKKSTFSLSSFLERLPRDF
FSHQEEETEEDSDLSDYGDDMDGRKDSLAEPCFMLIGEIFELRGMFKWVRRTLIALVQVT
FGRTINKRQIRDTVNWIFSEQMLVYYITVFRDAFWPNGKLAPPTKIRSKEQSQETKQRAQ
QKLLENIPDMLQNLVGQQNARHGIIKIFNALQETRANKHLLYVLMELLLIELCPELRAHG
DPLRAGQV
Download sequence
Identical sequences G1P649
ENSMLUP00000005525 ENSMLUP00000005525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]