SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005527 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005527
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000723
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005527   Gene: ENSMLUG00000006048   Transcript: ENSMLUT00000006052
Sequence length 1539
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430309:386698:427753:-1 gene:ENSMLUG00000006048 transcript:ENSMLUT00000006052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVEEGSKAAAVDKLLAGDEIVGINDIGLSGFRQEAICLVKGSHKTLKLVVKRRNELSWRP
HSWHATKFSDSHPETPTCQLSSAGACPSWHGRHHASASSQDLSGVWEPTSLQRTSDHFSS
LGSVDSLDQPSQPSPSGRLSAAKSSGSIDHLGGPSKRDSAYGSFCTSSSTPDHTLPKADA
SSTDNILYKVGLWEASRPGGRQDPQGLEERPGGFPPRGPLDSSRSPRPEDVPEPKLATSG
RSSFGPIWHVPDKKRAPPSPPPPPPPLRSDSFAATKSHEKAQGPSFPEAATAQHFPGLSR
AQSQGDWRAEPADPQRKLARPGERRRPESSGCAAAAPLDCGWPSNPGAPSRLHASLSSTD
VRFPPSAHACQHQRQCSDESPFLHEGLRQEAPAHSFQDASPTPARQPSAADRKGDSAGQS
HHHSVATRQGPQGGAQAAQPRDSCWRCSSPLGAHACPATHPAGQKPRCHPPQHQESLDAH
KGERGDPGDRGLEEPQRAPPRRQSRRAESRPPGRAAKISAHGTPLLHSLTRDGPRPEDGL
EGGRERPAPFDAQVGKATRRSDRFSTTLRNEIQLRRARLQKSKSSVALAAPAEAAGEAGS
WRGALGGPAPGAPLLGTYKDHLKEAQARVLRATSFKRRDLDPSPADRYAASREPRAGDHR
PDLDAAPQGVGPARPPSSGGGPSHVARIGGRKRFTVEQKLKSYSEPEKMNEVGLSGDHCP
RQHSEDTVGTFADRWKFFEETSRLVPQRPRSRQALPGVPKEKPDRPRATRLGDQGAEPRP
QDRARTTSFGENADGPRKAGRTGKSEPPQRLGTFAEYQASWRKQSKGPEARGSGRYHSAD
DILDVGLDQQERLQYVHERSRSSPSTDLYKQEAPIEPRRQAEDPGEHREHPSTVPAEDGG
PAPRQADAQCPEDGPGAHRGLRHPAQGSEPSRAPEAPEVPQEGRGRAGTLPRDYRYSEDH
APAVPLPPPGPGSQAQSGLSAPHAGGQDPRPVSAAPLAKRPAPQRPPPPKREPRPFRGPA
SATPAGTPAGNHLAVPSRPLPPPPSPARSPCVLAEKPSGAQPADGPKAPGEQDRQHVDEH
PACPKREALLPSKFRPLQTSAMETSRSPSPQFAPQKLTDKPPLLIQDDSSTRIERVIDNT
TVKMVPIKIVHSESQPERESRQGLARAAEPPALPSGLERDQIKTLSTSEQSYSRFCLYSR
PGTEPQPRAQPPAAPDSRASPPALSYGKARERTAEDLKSEELAREIVCKDRSLADILDPS
VKVRTTMDLMEGIFPKDQQLLEEAQQRRKLLPKVPSPRAAEDKREEPSVPSAVSLATNSA
YYSTSAPKAELLIKMKDLQEQQEPEEDSGSDLDHDLSVKKQELIDSIGRKLQVLRGARES
LLEDIQANSTLGDEVEAIVKDVCKPNEFDKFRMFIGDLDKVVNLLLSLSGRLARVENALN
NLDDSASPGDRQSLLEKQRVLVQQHEDAKELKENLDRRERVVFDILASYLSDESLADYEY
FVKMKSALIIEQRELEDKIHLGEEQLKCLVDSLQPERSK
Download sequence
Identical sequences G1P651
ENSMLUP00000005527 ENSMLUP00000005527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]