SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005533 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005533
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.15e-18
Family Regulator of G-protein signaling, RGS 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005533   Gene: ENSMLUG00000006062   Transcript: ENSMLUT00000006058
Sequence length 97
Comment pep:novel scaffold:Myoluc2.0:GL430112:3622:14249:1 gene:ENSMLUG00000006062 transcript:ENSMLUT00000006058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKYDSYS
RFLKSDLFLKHKRTEEEEEEPPDTQTAAKRASRTYNT
Download sequence
Identical sequences G1P657
ENSMLUP00000005533 ENSMLUP00000005533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]