SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005540 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005540
Domain Number 1 Region: 483-645
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.9e-65
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000399
Further Details:      
 
Domain Number 2 Region: 87-322,353-390,420-430
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-35
Family WD40-repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005540   Gene: ENSMLUG00000006058   Transcript: ENSMLUT00000006065
Sequence length 646
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:44482006:44506149:-1 gene:ENSMLUG00000006058 transcript:ENSMLUT00000006065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEAGSDSQLRRRRRRDPEEPEQTERKERELAVGAAMAQGNEEDDEERWVGPLPVEATL
AKKRKVLEFERVYLDNLPSASMYERSYMHRDVITHVVCTKTDFIITASHDGHVKFWKKVE
EGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQC
EWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHVFDKLHTSPLTQIRLNPVYKAVVS
SDKSGMIEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSICFSPDGKKIATIGS
DRKVRIFRFLTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLIN
IVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIE
MKASENPVLQNIQADPTIVCTSFKKNRFYMFTKREPEDTKSADSDRDVFNEKPSKEEVMA
ATQAEGPKRVSDSAIIHTSMGDIHIKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGF
MIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTP
WLDNKHTVFGRVTKGMEVVQRISNVKVNPKTDKPYEDVSIINITVK
Download sequence
Identical sequences G1P664
ENSMLUP00000005540 ENSMLUP00000005540 XP_006081468.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]