SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005543 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005543
Domain Number 1 Region: 5-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-134
Family Motor proteins 0.00000000000363
Further Details:      
 
Domain Number 2 Region: 1678-1775
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-25
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 500-590
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.24e-21
Family FHA domain 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005543   Gene: ENSMLUG00000006051   Transcript: ENSMLUT00000006069
Sequence length 1796
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:859548:913080:-1 gene:ENSMLUG00000006051 transcript:ENSMLUT00000006069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHT
SPEDINYASQKQVYQDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIP
QLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETDITTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAVI
NEDPNNKLIRELKDEVTRLRDLLYAQGLGDITDTNTVPGGPKLTNALVGMSPSSSLSALS
SRAASVSSLHERLLFAPGSEEAIERLKETEKIIAELNETWEEKLRRTEAIRMEREALLAE
MGVAMREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGLTRVGREDGERRQDIVL
SGHFIKEEHCVFRSDSRGGSEAVVTLEPCEGADTYVNGKKVTEPSILRSGTARQKARATL
RRWGPSAPRAVGIREGRALARGARLGGEPGMGWHHGKDGTWGKPGTALCKHPWLQRGRAE
RVIWXRREREEATYLLEQQRLDYESKLEALQKQMESRYFPEVNEEEEEPEDEVPWTEREC
ELALWAFRKWRWYQFTSLRDQLWGNAIFLKEANAISVELKKKVQFQFVLLTDTLYSPLPP
DLLPPEAAKDRETRPFPRTIVAVEVQDQKNGATHYWTLEKLRQRLDLMREMYDRAAEVPS
SVIEDCDNVVTGGDPFYDRFPWFRLVGSSVISGCSSYPLLNTCMSARMAALTPSPTSSSP
DSDTTEPAEEQSLGEEEEEEEEEEEEEDLEDDVFLEHALCHGRDPFYDRPPLFSLVGRAF
VYLSNLLYPVPLVHRVAIVSEKGEVKGFLRVAVQAISADEEAPDYGSGVRQSGTAKISFD
DQHFEKFQSESCPVVGMSRSGTSQEELRIVEGQGQGADAGPSADEVNNNTCSAVPPESLL
LDSPEKATLDGPLDAALDHLRLGSTFTFRVTVLQASSISAEYADIFCQFNFIHRHDEAFS
TEPLKNTGRGPPLGFYHVQNIAVEVTKSFIEYIKSQPIVFEVFGHYQQHPFPPLCKDVLS
PLRPSRRHFPRVMPLSKPAQCPHKLSTLTRSCPGTHCKYDLLVHFEICELEADGDYIPAV
VDHRGGMPCMGTFLLHQGIQRRITVTLLHETGSHIRWKEVRELVVGRIRNTPETDESLID
PNILSLNILSSGYIHPAQDDRTFYQFEAAWDSSMHNSLLLNRVTPYREKIYMTVSAYIEM
ENCAQPAVITKDFCMVFYSRDAKLPASRSIRNLFGSGSLRSSESNRVTGVYDLSLCHVAD
AGSPGMQRRRRRVLDTSVAYVRGEENLAGWRPRSDSLILDHQWELEKLSLLQEVEKTRHY
LLLREKLETTQRPAPETLSPASSEDSESHSLSSASSPLSADGRASPPETPNERQRELAVK
CLRLLTHTFNREYTHSHVCISASESKLSEMSVTLLQDTSLSPLGVATLTPSSTCPSLVEG
RYGAADLRSLQPNSRPASPEPENVPEADSKKIPSPARATESDKEPQRPLVPDIQEVRVSP
IVSKKGYLHFLEPHTAGWAKRYVVVRRPYAYMYNNDKDTVERFVLNLSTAQVEYSEDQQA
MLKTPHTFAVCTEHRGILLQASSDKDMHDWLYAFNPLLAGTIRSKLSRRRSAQMRV
Download sequence
Identical sequences G1P667
ENSMLUP00000005543 ENSMLUP00000005543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]