SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005549 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005549
Domain Number 1 Region: 402-566
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.44e-47
Family G proteins 0.00000262
Further Details:      
 
Domain Number 2 Region: 28-80
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000167
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 167-234
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000195
Family B-box zinc-binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005549
Domain Number - Region: 122-163
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00435
Family B-box zinc-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005549   Gene: ENSMLUG00000006070   Transcript: ENSMLUT00000006076
Sequence length 574
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:44443728:44477288:1 gene:ENSMLUG00000006070 transcript:ENSMLUT00000006076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVVNKAGSGLDSGRQGSWGTAVVKVLECGVCEDVFSLQGDKVPRLLLCGHTVCHDCL
TRLPLHGRAIRCPFDRQVTDLGDSGVWGLKKNFALLELLERLQNGHIGQYGAAEEAIGIS
GESIIRCDEDEAHVASVYCTVCATHLCSECSQVTHSTKTLAKHRRVPLADKPHEKTMCSQ
HQVHAIEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVLEPEANQIRASILDMAHCIRTF
TEEISDYSRKLVGIVQHIEGGEQIVEDGIGMAHTEHVPGTAENARSCVRAYFSDLHETLC
RQEEMALSVVDAHVREKLIWLRQQQEDMTILLSQVSTACLHCEKTLQQDDCRVVLAKQEI
TRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTI
LFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVD
SSHRDRVNEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRS
WYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA
Download sequence
Identical sequences G1P672 S7P4S7
XP_005858001.1.60319 XP_006081467.1.53796 XP_006762481.1.95426 ENSMLUP00000005549 ENSMLUP00000005549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]