SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005582 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005582
Domain Number 1 Region: 646-722
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-19
Family SH3-domain 0.0000341
Further Details:      
 
Domain Number 2 Region: 1752-1826
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-18
Family SH3-domain 0.00029
Further Details:      
 
Domain Number 3 Region: 1614-1694
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-17
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 882-1020
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000478
Family Fibronectin type III 0.00089
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005582
Domain Number - Region: 788-868
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00839
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number - Region: 332-516
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0199
Family FCH domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005582   Gene: ENSMLUG00000006101   Transcript: ENSMLUT00000006115
Sequence length 1855
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429925:2445664:2466446:-1 gene:ENSMLUG00000006101 transcript:ENSMLUT00000006115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLTTLLRLGDPGAMEPWAQPAWQSWIPGQEGEPGGAAPSTADTPAALQVGELRPLESS
EPEGAWSPGPVGDIDPEGTETGLPSLGQQAASSGPSCPRLEDEEVEAFHEGKLSVGFGDR
PSLELLRALRELRQHCALLKEENQRLRKSSFPETEEKVRRLKRKNAELAVIAKRLEERAR
KLQETNLKVVSAPVPRPGPSLELCRKALARQRTRDLSETASALLAKDKQIAALQRECREL
QARLTLAGKEGPQWLHLRDFDRLLRESQREVLRLQRQIALRNQQEPSPPLRPPGPTVRVK
AGAPTPRAPGEATPQEDVENPPVVLGEPEKQQRVQQLESELSKKRKKCQSLEQEARKKQR
RCEELELQLREAQNENARLVDENSRLSGRATEKDQVEWENAELRDQLLGVTQERDLALRK
SQGLQSKLESLEQVLKHMREVAQRRQQLEVEHEQAQLSLQEKQEEVRRLQQAQAEAKREH
EGAVQLLESTLDSMQVRVRELEEQCRSQTERFSLLAQELQAFRLHPGPLDLLTSALGCST
LGDRPPPPCCCSNPQPCRGSGPKDSDLLPGSPGRCTPKSSEPAPATLPGVPRRTAKKAES
LSNSSHSESIHNSPKSCPTPERVLGHHSQLFQSPPTSQTPAAPEGSRGGARIQVFLARYS
YNPFEGPNENPEAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDL
LTSLPSELADLSHSSGPELSFLSGGGGGSSSGGQSVGGRSQPRSEEETAGDELSLSPSPE
GLGEPHAVPYPRHLAVLKQLAHSVVLAWEPPPERVELHGYQICVNGELRQALGPGAPPKA
VLENLDLRAGPLRVSVQALTSRGSSDPLRCCLAMGARAGVVPSQLRVHRLTATSAEITWV
PGNSNLAHAIYLNGEECPPARPSTYWATFCNLRPGTLYQARVEAQLLPGGSWEPGWERPE
QRTATLQFTTLPAGPPDAPLDVQIEPGPSSGILIISWLPVTIDAAGTSNGVRVTGYAIYA
DGQKIMEVTSPTAGSVLVELSQLQLLQVCSEVAVRTMSPHGESADSLPAPVGPALAAACL
PARVSCPSPRPGSEARPPLAPASPAPGDPSSPLRYPEPHGTREPHGVPAASPPGETRGSQ
EEPTAPCSQEEAGAAVLGTSDDRRAREPAVGERAPGPAASSLARDEAEGTAGEACLAPCS
TEGAPVPKVPCAEASLGGDTGAGLRPRAEKEDMAELGVRLVNSLGDHGRNSDLSDIQEEE
EEEEEEALGSRACSFQKQVAGISVRENGPKPQPEPFSETDSDEEILEQILELPLQQFCSK
KLFSIPEEEEEEEEEEEEEEEQQQQPGAGSSSRDRSPQEPALLELGGDSRPQRPGPCPLS
PEPCSAGDHLEDMAGLAGGSSWGRGSGSTEKPPNRKRSPDPREHCSRLLSNGGTQAAGRP
GPTRERGGPPVGEGARGGPEAGGRGRPAPSQRYPHGRTPESILTSCLSPKCLEISIEYDS
EDEQEAGGGGVSITSSCHFRDGEAWGTAPIGRSRGALKANSGPSPYPRLPAWERGEPERR
GCSATGRAKEPASRATEIGEPRGQDGSGQRGPLRRGARVPRPDATELAPPRSRPEEVLAH
QDLPVRVFVALFDYDPVSMSPNPDAGEEELPFREGQILKVFGDKDADGFYRGEGGGRRGY
IPCNMVAEVAVDTPAGRQQLFQQGYLSPRVLVEGSDSLAFLSSTARTTGPPPKPRRSKKA
ESEGPAQHGAGPPEPVSSASLRAPRCMVAAFDYNPRESSPNMDVEAELPFRAGDIITVFG
GMDDDGFYYGELNGQRGLVPSNFLEGPGPEAGSSHREPGTPPAESQRTRKRRVQC
Download sequence
Identical sequences G1P693
ENSMLUP00000005582 ENSMLUP00000005582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]