SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005606 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005606
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.32e-39
Family CAD domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005606   Gene: ENSMLUG00000006142   Transcript: ENSMLUT00000006139
Sequence length 238
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429775:15270760:15280752:1 gene:ENSMLUG00000006142 transcript:ENSMLUT00000006139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYAMKSLSLLNPKSLSRYVAVSTSVVTQQLLSEPSPEPLRARPCRVSTQDRSVRKGIMA
HSLEDLLHKVRDTLMLADKPFFLVLEEDGTVVETEEYFQTLADDTVFMALQKGQKWQPPS
DQGSRYQLSLSRKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATLYGTYSLSYNLHCYGA
KRVMKEALRWALFSMQATGHMLLGTSCYMQQLLDATEEGQPPKGKAPSLLPTCLKILQ
Download sequence
Identical sequences G1P6B5
ENSMLUP00000005606 XP_006083926.1.53796 XP_006083927.1.53796 ENSMLUP00000005606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]