SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005611 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005611
Domain Number 1 Region: 142-693,869-1064
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.68e-234
Family Motor proteins 0.0000000132
Further Details:      
 
Domain Number 2 Region: 2129-2319
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.61e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000767
Further Details:      
 
Domain Number 3 Region: 16-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000155
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 4 Region: 2063-2122
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0063
Further Details:      
 
Domain Number 5 Region: 1074-1164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000276
Family Extended AAA-ATPase domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005611   Gene: ENSMLUG00000006117   Transcript: ENSMLUT00000006144
Sequence length 2626
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:2479740:2819274:-1 gene:ENSMLUG00000006117 transcript:ENSMLUT00000006144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNINDGGRRRFEDNEHTLHIYPGTISEGTIYCPIPARKNSTAAEVIDSLINRLHLDKTKC
YVLAEVKEFGGEEWILNPTDCPVQRMMLWPRMALENRLSGEDYRFLLREKNLDGSIHYGS
LQSWLRVTEERRRMMERGFLPQPQQKDFDDLCSLPDLNEKTLLENLRNRFKHEKIYTYVG
SILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHTMLQRKKNQCIVISGE
SGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKFI
QVNYQETGTVLGHTYMHMYIHTKSKVIRLKHNQNTEKIFVYLIMRKSELERYILVLTHPE
KKHFFKKITKKPLRQSWDDYCCDSEPDCFTVEGEDLKHDFERLQLAMEMVGFLPKTQRQI
FSLLSAILHLGNICYKKKTYRDDSIDICNPEVLPVVSELLEVKEEMLFEALIMRKTVTVG
EKLILPYRLAEAVTVRNSMAKSLYSALFDWIVFRINHALLNSKDLEQNTKTLSIGVLDIF
GFEDYENNSFEQFCINFANERLQHYFNQHIFKLEQEEYRAEGISWHNIDYIDNTCCINLI
SKKPTGLLHLLDEESNFPQATNQTLLDKFKHQHEENSYIEFPAVMEPAFTIKHYAGKVKY
GVKDFREKNTDHMRPDIVALLRSSKNAFISGMIGIDPVSVFRWAVLRAFFRAMVAFREAG
KRHIQRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSVTRKNPRTPLS
DLQGINTLNEKNQHDTFDIAWNGRTGIHQSRLSSNTSLLDKDGIFANSASSKLLERAHGI
LTRNRNFKFKPGLPKHLLEVNSLKHLTRLTLQDRITKSLLHLHKKKKPPSISAQFQASLN
KLMETLGQAEPYFVKCIRSNAEKLPLRFNDALVLRQLRYTGMLETVRIRQSGYSCKYSFQ
DFVSHFHVLLPRNTIPSKFYIQDFFRKININPNNYQVGKSMVFLKEQERQHLQDLLHQEV
LRRIILLQRWFRVLLCRQHFLHLRQASVIIQRFWRNYLNQKQVKDAAVQKDALVMASAAT
LLQASWHAHLERQRYLELRTATIIIQQRWRECYRWRHMAAICIQARWKGYRENKKYQEQR
NKIILLQSICRGFRARQRFKALKEQRLKETKLELGLMNIEPHGALKIQGSDPSEWEDCSF
DNRVKAIEECKSVIESNRISSVDCLKDSPNKRQERARSQSGVDLQEDVIIRERPKSLEDL
HQKKVGRAKRESRRMRELEQAIFSLELLKVRSLGGVSPSEERRWSTELMPEGLQSLQGTP
DSESSQESLELLSCEESQKSKLESVMLDEGDLQFLSPKISSSQKFDSQANARSTSSETNY
TLSQKGASSDSMHLKNGTMKEKLVCSSESITCKPQLRDSFVSSSLPTFFYIPQQDPLKTS
SQLDTSIQRNKLMESEETIPALTLDINRKTRKYRYSGENQVVALSTDSSNTVLKKLEKLN
TEKEERQKQLQQQNEKEMMEQIRQQTDILERERKTFKTIEKQRIGESFPVSSFYQSKPRV
ERPSSLLIPNTPNKKESDVLGHPSVTVKDAALALKDSPSAHFPLKDRPATLFFERKGGPC
QSSTVNELSKTDRMCNQPNVACKFNNNGISKREHFKPTQSKSHKSNDPPRDGTTMAIFFT
PKENVCLEFLNSGNPKVHKQDEPIWKPMKLTGPGQGEVARPAHKKKARMARTRSDFLTRG
TFADGEGDTEEDDYDDIEPLLSLDQPSHSELGPAPILGQASHSDSEMTSQRFSSVDEETK
LHKTMSQGEIAKLAVREKSSDSDIRPQKARMRFWAKGKQGEKKTTRVKPATQSEVLPLLA
GSDMIPMHQFPDELAQYHPTPPLSPELPGSCQKEFKENKEPSPKAKRKRSVKISSLALES
MHWQNDSVQIIESASDLKSMDEFLLKKMNDLDNEDSKKDTLVDVVFKKALKEFRQNIFSF
YSSALAIDDGKSIRYKDLYALFEQILEKTMRLEQRDWRESPVRVWVNTFKVFLDEYMNEF
KTLDCIPPKVPKTERKKRRKKETDLVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASV
CKLCKYACHKKCCLKTIAKCSKKYDPELSSRQFGVELSRLTSEDRTVPLVVEKLINYIEM
HGLYTEGIYRKSGSTNKIKELRQGLDTEIDAESVNLDDYNIHVIASVFKQWLRDLPNPLM
TFELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLERLIFHLVRIALQENTNRMSA
NALAIVFAPCILRCPDTIDPLQSVQDISKTTTCVELIVVEQMNKYKARLKDISSLEFAEN
KAKTRLSLIRRSMKPVLIAVRFMSITRSSVSGKGCLRRGNYASPSSPVVVRLPSMSDVPE
ETLTSEAAMEMDITEQQQAAMQQEERVLTEQIENLQKEKEELTFEMLILEPRASDDETLE
SEASIGTADSSENLNIESEGLERSLALSSLRAAGKSAPSSKLRKQLKKQHDSLDSVDSSV
SSHGTRKRFQIYSKSPFYRAGSAGEALEMEGPLGLTKSLEDRPQFISRGTFNPEKGKQKL
KNVKNSPQKTKETPEGTVGSGHRKTVDPDCSSTQQPALFGNNEFMV
Download sequence
Identical sequences G1P6C0
ENSMLUP00000005611 ENSMLUP00000005611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]