SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005624 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005624
Domain Number 1 Region: 157-260,302-573
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.08e-146
Family Myotubularin-like phosphatases 0.0000000626
Further Details:      
 
Domain Number 2 Region: 1108-1175
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.8e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 50-132
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000205
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005624   Gene: ENSMLUG00000006147   Transcript: ENSMLUT00000006158
Sequence length 1193
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429925:2588900:2605620:-1 gene:ENSMLUG00000006147 transcript:ENSMLUT00000006158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGEEGPPSLEYIHAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELVRMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRATGGSLGTGNSDASEACDTDFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPGSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQETRAGLEPWHSNPEGSETAFME
SGVGGPQQTVGEMGLPSPLPSSQKDYLSNKPFKSHKSCSPSYKLLSATVPQEMKSNSSDP
EIKVLEETKASAPDPPAQEVLCRTLDGTEEPPEHFPEKEAVSALSKVISNKCDRICDFPE
SSQDSLTGAPQQAQLGSVLGVPSRSAPDHSLGILCNPPNATCQTPPDPSTDFLNQDPPES
VASISHQEQPSSVPDLIDGEEDTDKKGNNRNGQLLENPRFGKVPLDLARKPISQSQIRSN
WDSFQGMVTSFPSGETTPRRLLSYGCCSKRSSSKQMRPIGPCFGGQWVQREGVKSPLCSS
HSNGHCTGPGGKNRIWLSGHPKQVSNTKPVPLSCPSPVPPLYLDDDGLPFPTDVIQHRLR
QIEAVYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFGDDLTCLKESDGSDTE
DFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCGNV
FCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQHLKKPIATASS
Download sequence
Identical sequences G1P6D2
ENSMLUP00000005624 ENSMLUP00000005624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]