SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005661 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005661
Domain Number 1 Region: 617-757
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-32
Family Synaptotagmin-like (S variant) 0.05
Further Details:      
 
Domain Number 2 Region: 18-148
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.18e-25
Family PLC-like (P variant) 0.0000018
Further Details:      
 
Domain Number 3 Region: 1456-1586
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-22
Family Synaptotagmin-like (S variant) 0.021
Further Details:      
 
Domain Number 4 Region: 484-543
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000598
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005661   Gene: ENSMLUG00000006184   Transcript: ENSMLUT00000006196
Sequence length 1628
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430013:88066:195616:-1 gene:ENSMLUG00000006184 transcript:ENSMLUT00000006196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLLFLFAVKRAKFQGSPEDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLG
LSVEVWNKGLIWDTMVGTVWIALKTIRQSNEEGPGEWSTLEAETLMKDDEICGTKNPTPH
KILLDTRFELPFDIPEEEARYWTYKLEQINALGADNEYSIQEESQRKPLPSAAAQCCHWT
YLGWGEQQTFEDPDSAVDDRDSDYRSETSNSIPPPYHSTSQPNASVHQFPVPVRLPQQLL
LQGSSRDSCNDSMQSYDYDLDYPERRALSPTSSSRYDSSCNVSQGSSQLSELDQCHEQDD
DRREKDSIHSCHSSGSFSRDVQVAFGEQEKTLEVPGEVEKGRACEPKEMKDVTTHPTPDL
VLQKDHVLGPQESFPEETASSPFTQARAHWIRAVTKVRLQLQEIPDDGDSSLPQWLPEGP
AGGLYGIDSMPDLRRKKPLPLVSDLAMSLVQSRKAGITSAMATRTSFKDEELKSHVYKKT
LQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLN
ADCLQRAAEKSCKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQM
KTVKQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLN
PVWEEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMD
VWYNLEKRTDKSAVSGAIRLQINVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGNGGVQ
IPEARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTL
LANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSP
ERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYS
HQYQLNKKQELPAEEQGPSIRNLDFWPKLITLIVSIIEEDKNSYTLVLNQFPQELNVGKV
SAEVMWQLFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVRDLPALQGQVPEYP
AWFEQFVLQWLDENEDVSLEFLHGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEI
IRKLECPDPNILAHYMRRFTKTIRKVLMQYADILSKNFPAYCTKEKMPCILMNNMQQLRV
QLEKMFEAMGGKELDSEAADSLKELQVKLNTVLDELSVVFGNSFQVRIDECIKQMADILS
QVRGPGNASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVLN
TMERMIVLPPLTDHTGTQLIFTAAKELSHLSKLKDHMVREETRSLTPKQCAVLDLALDTI
KQYFHAGGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFT
ANEDIRPEKGSGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLRWQTAGMFRPFVE
VTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLGNEEGPEAYELQICVKDYCFARED
RVLGLAVMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSE
SRSLEEGS
Download sequence
Identical sequences G1P6G8
ENSMLUP00000005661 ENSMLUP00000005661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]