SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005663 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005663
Domain Number 1 Region: 136-300
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.61e-72
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000305
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.13e-26
Family Canonical RBD 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005663   Gene: ENSMLUG00000006201   Transcript: ENSMLUT00000006198
Sequence length 301
Comment pep:novel scaffold:Myoluc2.0:GL431162:16446:17351:-1 gene:ENSMLUG00000006201 transcript:ENSMLUT00000006198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYEREKHRGFAFVEFELAEDA
AAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSE
PPKAEAQEGEPTAKKARSNPQVYMDIKIGNKPAGRIQILLRSDVVPMTAENFRCLCTHEK
GFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSG
PNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKEKVIISDCGEY
L
Download sequence
Identical sequences G1P6H0
ENSMLUP00000005663 XP_006107843.1.53796 ENSMLUP00000005663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]