SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005694 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005694
Domain Number 1 Region: 476-671
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.63e-61
Family Nucleotide and nucleoside kinases 0.0001
Further Details:      
 
Domain Number 2 Region: 322-462
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-29
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 119-177
Classification Level Classification E-value
Superfamily L27 domain 1.53e-22
Family L27 domain 0.0000458
Further Details:      
 
Domain Number 4 Region: 253-337
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-19
Family PDZ domain 0.000032
Further Details:      
 
Domain Number 5 Region: 184-235
Classification Level Classification E-value
Superfamily L27 domain 0.000000000259
Family L27 domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005694   Gene: ENSMLUG00000006234   Transcript: ENSMLUT00000006236
Sequence length 675
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429852:1833971:1881981:1 gene:ENSMLUG00000006234 transcript:ENSMLUT00000006236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSHMNGHVTEESDGEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPVRRSAQLERIR
QQQEDMRRRREEEGKKQELDLNSSMRLKKLAQMPPKTGIDNPIFDTEEGIVLESPHYAVK
ILEVEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQSKDFQNAFKIHNAVTVHMSKASPPF
PLISNAQDLAQEVQIVLKSIHQKEGQELTALLNAPHIQALLLAHDKVAEQEMQLEPITVE
RVYESVGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE
VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSD
DPYVPCRELGLSFQKGDILHVISQEDPNWWQAYRDGDEDNQPLAGLVPGKSFQQQREAMK
QTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKR
PIILIGPQNCGQNELRQRLMNKEKDRFAAAVPHTTRNRRDHEVAGRDYHFVSRQAFEADI
AAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLRTLRNSDLKPYIIFIAPP
SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLIN
KLDTEPQWVPSTWLR
Download sequence
Identical sequences G1P6J8
XP_006091054.1.53796 ENSMLUP00000005694 ENSMLUP00000005694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]