SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005705 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005705
Domain Number 1 Region: 280-404
Classification Level Classification E-value
Superfamily TRAF domain-like 9.65e-24
Family MATH domain 0.0036
Further Details:      
 
Domain Number 2 Region: 7-75
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000278
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 3 Region: 90-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000733
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005705   Gene: ENSMLUG00000006229   Transcript: ENSMLUT00000006247
Sequence length 964
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429925:2863890:2939390:-1 gene:ENSMLUG00000006229 transcript:ENSMLUT00000006247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQI
RELVNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALW
GGMHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVR
EIRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK
SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSPP
LQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKNII
REFASDFEVGECWGYNRFFRLDLLANEGYLNRQNDTVILRFQVRSPTFFQKCRDQHWYIT
QLEAAQTSYIQQINNLKEKRLTIELSRTQKSRDLSPPANHLSPQNDDSPETRSKKSGSCA
DMLLQDGPISASVREAKEDEDEEKIQNEDYHHELSDGDLDLDLVGEDEVNHLDGSSSSAS
STATSNTEENDIDEETMSGENDVEYNNMELEEGELMEDSAAAGPPVGGNHGYVGASSRMS
RRTHLCSATTSNLLDIDPFILMHLLDLKGRNSMESLWGLQPRPPASLLQPTVSYCRKDKD
QRKQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKNPLSEIKSSNAPSGDMQTSLFSADQ
AALAACGTENSGRLQDLGMELLAKSSVASCYIRNSTNKKSNSPKPARSSIAGSLSLRRAV
DPGENSYSRGDCQPLSEVSPGSSQSGSRHSSPRALTHGSFGDILPKSEDLQSQALDSNAI
VVAVINGLPAVEKRRKMVTLGANVKGGRLEGMQMTDLENNSETGELQAILPEGASAAPEE
GMSSDSDVECDTENEEQEEHTSLGGFNDAFTAQPPDEDTHSSFPDGEQIGLEDLSFNTED
NSGR
Download sequence
Identical sequences G1P6K8
ENSMLUP00000005705 ENSMLUP00000005705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]