SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005706 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005706
Domain Number 1 Region: 251-297
Classification Level Classification E-value
Superfamily UBA-like 0.0000000117
Family TS-N domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005706   Gene: ENSMLUG00000006249   Transcript: ENSMLUT00000006248
Sequence length 475
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429804:5564539:5567369:-1 gene:ENSMLUG00000006249 transcript:ENSMLUT00000006248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRSELPSVPGAATAATTATGPPVASVASVAAAAAAAASLPVSVAGGLLRAPPLLLRAA
EKYPEENEARELQLLYGTAEGLALAAANGIIPPRPAYEVFGSVCAADGGGPGAGAPAGTG
GGAAGAGSSEAKLQKFDLFPKALLQAGRPGSPPPPPGKPLSPDGADSGPGTSSPEVRPGS
GSENGDGESFSGSPLTQASKEAGGSCPGSAGPGGGGEEDSPGSASPLGSESGSEADRERE
APPAPGLGGAPGPRQRTPLDILTRVFPGHRRGVLELVLQACGGDVVQAIEQVLNHHRGGL
AAGLGPTAPSDKAAVGAAANAEDGWLSRVDAAAGGPGLPAPLQAGPAAPPHHRLLLGAMA
PGTLGSLSSRSAFSPLQPNASHFGAADAGAYLGAPLGLSPLRLAYSAAAAHSRGLAFMAP
YSTAGLVPLGFRPPMDYAFSDLMRDRSAAAAAVHKEPSYGGGLYGPMVNGAPEKQ
Download sequence
Identical sequences G1P6K9
ENSMLUP00000005706 ENSMLUP00000005706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]