SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005717 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005717
Domain Number 1 Region: 524-639
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.69e-28
Family UBX domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 325-477
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000313
Family UAS domain 0.086
Further Details:      
 
Domain Number 3 Region: 80-168
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000153
Family Ubiquitin-related 0.022
Further Details:      
 
Domain Number 4 Region: 178-249
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000497
Family Ubiquitin-related 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005717
Domain Number - Region: 3-34
Classification Level Classification E-value
Superfamily UBA-like 0.0281
Family TAP-C domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005717   Gene: ENSMLUG00000006252   Transcript: ENSMLUT00000006262
Sequence length 641
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429804:5587769:5929733:-1 gene:ENSMLUG00000006252 transcript:ENSMLUT00000006262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSDYGSETISGPAFDP
ASHPAPAPAPSSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDSCTVGEIKQI
LENELQIPVSKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSSHASALQE
SLNQNFMLIITHREVQREYNLNFSGSSTIQEVKRNVYDLTSIPVRHQLWEGWPTSATDDS
MCLAESGLSYPCHRLTVGRRSSPTQTREQSEEQSTDVHMISDSDGDDFEDAPEFGVDDGE
VFGMASTALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVK
ARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDANRARFLTMC
NRHFGSVIAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFT
AQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQSRLEQIRKEQEE
EREAIRLSLEQALPPEPKEDAEPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVTSKGFP
WNEFKLLSTFPRRDITQLDPNKSLLEVKLFPQETLFLEAKE
Download sequence
Identical sequences G1P6L6
ENSMLUP00000005717 ENSMLUP00000005717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]