SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005744 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005744
Domain Number 1 Region: 273-358
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.68e-19
Family SPRY domain 0.0047
Further Details:      
 
Domain Number 2 Region: 43-99
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000641
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005744   Gene: ENSMLUG00000006291   Transcript: ENSMLUT00000006291
Sequence length 363
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430252:605731:608835:-1 gene:ENSMLUG00000006291 transcript:ENSMLUT00000006291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPECREFCPARTELRRNVPLSDVVEVVRAEPRPPAPNPDPDPGARCPQHGRPLELFCRTD
GRCVCSSCTVGDCRLHERVLLDVERREREAQLRAMLEVTRQQATQVESQLQELQQRSSQI
QSSACNLASVVSGKFSRLLQALEMRRIKALRAIEVAKTQALAQAQEEEQRLRGHLEATAV
FDRWTQDLLEQSDRTFLQGSQLLAPPGPLGPLSPPQWDADQQLDGLKEFLSQLCGLLLDN
GDPRGAPAEAADLGPPETPDALALVPSPVCSLRRKLWQNYRNLTFDPESANRHLHLSRQD
RRVEHRREPRGPAEPGSFELWQVQCAQSFQSGRHYWEVHTSNHLVTVGVAYPDLARRKLG
PYT
Download sequence
Identical sequences G1P6N9
ENSMLUP00000005744 ENSMLUP00000005744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]