SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005779 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000005779
Domain Number - Region: 148-188
Classification Level Classification E-value
Superfamily UBA-like 0.000582
Family CUE domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005779   Gene: ENSMLUG00000006328   Transcript: ENSMLUT00000006328
Sequence length 285
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429929:892888:900665:-1 gene:ENSMLUG00000006328 transcript:ENSMLUT00000006328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEM
MEAYVPGFAHIPRGTIGDMLQKLSGQLSGARNKENLQPQSSEVQGHVPISPEPLQRPEQL
KEETRASPAAGDTQDEAASAEEELLSGVDVLLEVFPTCSMEQAQWVLAKARGDLEEAVQM
LVEGKEGPPAWDGPNQDLSRRLRGPRKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPK
KLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
Download sequence
Identical sequences G1P6S3
XP_006095949.1.53796 XP_006095950.1.53796 ENSMLUP00000005779 ENSMLUP00000005779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]