SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005784 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005784
Domain Number 1 Region: 177-271
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 2.35e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000184
Further Details:      
 
Domain Number 2 Region: 256-371
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.8e-33
Family UBX domain 0.00000195
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000148
Family TAP-C domain-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005784   Gene: ENSMLUG00000006335   Transcript: ENSMLUT00000006333
Sequence length 373
Comment pep:novel scaffold:Myoluc2.0:GL430832:9557:34729:1 gene:ENSMLUG00000006335 transcript:ENSMLUT00000006333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAERQEALREFVAVTGTEDDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTVSSISSDNRVTSFKDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKRSPNE
LVDDLFKGAKEHGAVAVEQMTRSPGETSKPKPFAGGGYRLGAAPEEESAYVAGERRRHSS
QDVHIVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMED
HRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLNTVFPAQQAENEAKASSSISIDESQPTTN
IQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKE
ANLLNAVIVQRLT
Download sequence
Identical sequences G1P6S8
ENSMLUP00000005784 ENSMLUP00000005784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]