SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005815 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005815
Domain Number 1 Region: 17-97
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000359
Family PDZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005815   Gene: ENSMLUG00000006351   Transcript: ENSMLUT00000006365
Sequence length 4765
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430498:231288:247168:1 gene:ENSMLUG00000006351 transcript:ENSMLUT00000006365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKEEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVVQNSPAARTGVVKEGSGDQIVG
ATIYFDNLQSGEVTQLLSTMGHHTVGLKLHRKGDRSPEPGQTWTHEVFSSRTSEVVLSGD
DEEYQRIYATKIKPRLKSEDGVEGEPGETQSRTITVTRRVTAYTVDVTGREGAKDIDISS
PEFKFKIPRHELTEISTVDVETQSGKTVIRLPSGSGAASPATGSAVDIRAGSIATSGPEL
HGAGHSKLQVTVPGIKVGSPDISVGAKGLDLGGKGGIHVPGVGISSSLGGGAVEVQGPSL
ESDNNGKIKIPTMKMPKFGVSTGPQHQAPEAGLSVSAPEFSVGHKGGQPGMTIGAPCATV
QGLKGKLKGPQITGPSFEGDLGLKGAKPQGSIGVDISAPQIKGTITGPHVEGQGPDVDIH
GPGGKLNMPKMKAPKFSVSGSKGEGTGIDVTLPTGDMTLPGVSGGVSLPEVATGGLEGKL
KGTKVKTPEMIIQKPKISMQDVDLSLGSSKLRGDIKVSAPGMQGDVKGPQVAVKGSKVDI
ETPSLEGTLVGPKLSGPSGKMGTCSISMADVDLNVAAPKVKGGVDVTLPKVEGKVKVPEM
DVKGPKVDVSAPDVELHGPEWNLKMPKMKMPKFSTPGVKGEGSDIDVNLPKGDVRITGPS
VNMEAPDVNIGGLGGKLKGPDMKLPEVSVKTPKISMPDVDLHVKGPKVKGEYDVTVPKLE
GELKGPQMDVNAPDVDVHGPEWHLKMPKMKMPKFSVPGFKAEGPDVDVNLPKPDVDISGP
KVDVTAPDVRIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHLKGPSVKGEYDVTVPKA
EGEIKVPDVELKSAKLDIDVPDVDVQGPDWNLKMPKMKMPKFSMPGFKAEGPDVDVNLPK
ADIGISGPKVDVDIPDVNIEGPEGKLTGPKFKMPEMNIKAPKISMPEVDLHMKGPKVKGE
YDVTVPKLEGDLKGPKVDVSAPDVEVHGPDWNLKMPKMKMPKFTMPSLKGEGPELDVNLP
KADVDLSAPKIDVSAPDLSLEGPEGKLKGPKFKMPEMHFKAPKMTLPDVDLNLKGPKMKG
NLEMSAPKLEGEMTVPDVDLKGPSVDIKAPDVEVQGGDWSLKMPKMKMPKFSVPGFKAEG
PEVDVNLPKADIDISGPKVDIEAPDMSLEGPEGKLKGPKFKMPDMHFKAPKISMPDVDFN
LKGPKVKGDVDVSVPKIEGEMKVPDVDIKGPKVDVDVPDVDVHGPDWHLKMPKMKMPKFS
MPGFKAEGPEVDVNLPKADIDISGPKVDIEAPDVSLEGPEGKLKGPKFKMPDMHFKAPKI
SMPDVNLNLKGPKLKGDADVSLPDVEGEIKIHGPDWHLKMPKVKMPKFSMPGFKGEGPEV
DVNLPKADLDVSGPKVDVEVPDVNIEGPDAKLKGPKFKMPEMNIKPQKIPIPDVGLHLKG
SKMKVDYDVTVPKVEGEIQTPDVNIKGPKVDINAPDMGVHGPDWHLKMPKVKMPKFSMPG
FKGEGPEVDVNLPKADINVSGPKVDINAPDVTLEGPEGKLKGPKFKMPSMNIQTHKISMP
DVGLNLKAPKLKTDVDVSLPKVEGDLKVPEIDVKAPKVDVDVGDIDIECPEGKIKGPKFK
MPDMHFKAPKISMPDVDLHLKGPKVKGDVDVSVPKIEGEMKVPDVDLKGPKVDIAAPDVD
VHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADIDISGPKVDIEAPDVSLEVPEG
KLKGPKFKMPDMHFKTPKISMPDVDLHLKGPKVKGNVDVSVPKLEGDLKGPRVDVEVPDV
DLECPDAKLKGHKFKMPDMHFKAPKISMPDVDFNLKGPKVKGDVDVSVPKIEGEMKVPDV
DLKGPKVDVDVPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNLPKADIDISGPK
VDIEAPDVSLEVPEGKLKGPKFKMPDMHFHAPKISMPDVDLHLKGPKVKGDVDVSVPKLE
GDLKGPSVDVKVPDVDLECPDAKLKGHKFKMPDMHFHAPKISMPDVDFNLKGPKIKGDLD
VSAPKMEGELKGPELDVKGPKLDVDMPDVAVEGPDGKWKSPKFKMPDMHFKTPKISMPDI
NLHLKSPKVKGEVDVDVPKLEGDLKGDISGPDIDIEGPEGKLKGPKFKMPDMHFKAPNIS
KPDVDLNLKGPKIKGDVDVSVPEVEGKIKVPDVNVKGPKVDISAPEVHGPDWHLKMPKMK
MPKFSMPGFKGEGPEVDVNLPRADIDVSGPKVDIEAPDVSIEGPEGKIKGPKFKMPEMNI
KAPKISMPDVDLHLKGPKVKGDIDLSLPKVEGDLKGPKVDIDAPDVDVQGPDWHLKMPKM
KMPKFIMPGFKGEGPEVDVNLPKADIDVTGPKVDIEGPDVNIEGPEGKLKGPKFKMPEMN
IKAPKISMPDFDMHLKGPKVKGDVDVSLPKVEGPEVDIKGPKVDVDVPDVDVHGPDWHLK
MPKVKMPKFSMPGFKGEGPEVDVNLPKADISVSGPKVDIEGPDVNIEGPDAKLKGPKFKM
PEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEGEIKVPEVDIKGPKVDIDVPDVDV
HGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADFDVSGPKVDIEGPDVNIEGPDAK
LKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLPNVEGDLKGPTLDIKGPKVD
LDAPAVDIHGPEGKLKGPKVKMPDMHVNMPKISMPEIDLNLKGSKLKGEVDVSGPKLEGD
IKAPKLDVKGPEVDISGPKLNIEGKSKKSRFKLPKFNFSGSKVQTPEVDVKVKKPDIDVT
GPKVDINAPDVEVQGKVKGSKFKMPFLSISSPKVSMPDVELNLKSPKVKGDLNVAGPDVE
ADFKGPQVDIKAPEVHLDAPDVDVHGPDWNLKMPKMKMPKFGVPGFKAEGPDMSVDLPKG
DINIEAPKVDIEGPEINVEGLEGGLKGPRLKMPDMNIKAPKISMPDIDLNLKGPKVKGDV
DVSLPKVEGELKGPGIDIKGPKVDIDVPDVDVHGPDWHLKMPKVKMPKFSMPGFKAEGPD
VDINLPKADIDVPDVSLEGPDAKLKGPKFKMPEMNIKAPHISMPDIDLNLKGPKMKGDLD
VSLPKVEGDLKGPEVDIKGPKVDIDTPDINIEGPEGKLKGPKFKMPEMHLKAPKLSMPDI
DLNLKGPKVKGDMDVSLPKMEADLKGPEIDIKGPKVDMNAPDVDVHGPDWHLKMPKVKMP
KFSMPGFKGEGPEVDVNLPKADIDVSAPKVDLEGPDMNIEGPEGKLKGPKFKMPEMNIKA
PKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDINAPDVDVHGPDWHL
KMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPKVDVEMPDVNIEGPDAKLKGPKFK
MPEMNIKAPKISMPDFDLHLKSPKVKGDVDVSLPKVEGDLKGPDVDIKGPKVDIDVPDVD
VHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADIDVSGPKVDIDTPDIDIHGPEG
KLKGPKFKMPDLHLKAPKISMPEVDLNLKGPKVKGDVDVSLPKVEGDLKGPELDIKGPKV
DIDVPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADFDVSGPKVDIDVPD
VNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGDVDVSLPMVEGDLKGPG
IDIKGPKVDIDVPDVDMHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADISVSGP
KMDIDVPDVNIEGPDAKLKGPKFKMPEINIKAPKISMPDVDLDLKGPKVKGDFDVSVPKM
EGTFKGPEVDLKGPGLDFEGPDAKLSGPHLKMPSLDISAPKVTVPDVDLHLKTPKIGISG
PKLEGGELDLKGPKVDLEAPTLDVHMESPDVNLEGPDVKIPKLKKPKLGFGAKGPKADFK
SPSVDVTVPEAELNVEAPEISVGGKGKKSKFKMPKIHMSGPKIKTKKQGFDLNVPGGEID
ASLKAPDVDVNVAGPDATLKVDVKSPKTKKSMFGKMYFPDVEFDIKSSKFKAEASLPSPR
MEGEIQACDLDVSSPGINVEAPDVHIEGPDAKVRAPSFGISAPQVSVPDVNVSLKGPKVK
GDVPSVGLEGPDVDLQGPEAKIKFPKFSMPKIGVPGVKMEGGGAEVHAQLPSLEGNLSAP
GVKLEGPDVSLKGSRVDLPSVNLSMPKVSGPDLDLNLKGPSVKGDLGVSGDIKCPKVSVG
APDLSWEAPEGGIKLPQMKLAQFGISTPGSDLDVNIKGPQVTGELKGPGMDVNLGGLNVK
GPQISAPDVDLNLEGPKVRGLGGTGELHGPSVGGGLPGVSVHGLEGNLHMPGIKAPACGL
ELQGGKVRLPTGQVSGPEIKGDLKSSGIGVHGAAPDISVKGPSFAMASPESELGVSLKGP
KIKGGVDVSGGVSAPDISLGEGHLGTKGSGVEWKGPQVSALDLGAPTLAGGLHFSGPKVE
GGGKGGQIGLQGPGLSVSGPQGHLESRSGKVTFPKMKIPKFAFSGRELVGREVGVDINFP
KGEASVQAGAGEGEWEESDVKLKKSKIKMPKFNFSKPKGKGGVTGSPEASISGSKGDLKS
SKASLGSLEGEVEAEASSPKAKFSLFKSKKPRHRSNSFSDERELSAPSTPTGTLEFEGGE
VSLEGGKVKGKHGKLKFGTFGGLGSKSKGHYEVTGSDDEAGKLQGSGVSLASKKSRLSSS
SSNDSGTKVGIQLPEVELAVSTKKE
Download sequence
Identical sequences G1P6V8
ENSMLUP00000005815 ENSMLUP00000005815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]