SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005842 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005842
Domain Number 1 Region: 476-836
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.79e-120
Family Oxysterol-binding protein 0.0021
Further Details:      
 
Domain Number 2 Region: 50-143
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-17
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005842   Gene: ENSMLUG00000006392   Transcript: ENSMLUT00000006397
Sequence length 841
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430021:383210:395028:-1 gene:ENSMLUG00000006392 transcript:ENSMLUT00000006397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQERGPPSLSESTQSAKSSSAQQASELWEVVEEPRGRRGAEGIMPERQEGHLLKKRKW
PLKGWHKRYFVLEDGILRYATTRQDITKGKLHGSIDVRLSVMSINKKAQRIDLDTEDNIY
HLKIKSQDLFQSWVAQLRAHRLAQRLDMPRGLLPSNSHRKVPGAQLPTVVSASALPGVGP
REKVSSWLRGSDGLDRCSHELSECQGKLQELHRLLQSLESLHRIPSAPVIPTHQASVTTE
RPKKGKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNLSRYLESRDHSGPRGLPPPDYAHLQ
RSFWALAQKVHSSLSSVLAALTAERDHLRDLHQGSELSRMGLSEASAGPRRLHSLSISSD
TTADSFSSLNPEEQEALYMKGRELTPQLSQSSVLSLADSHTEFFDACEVLLSASSSENEG
SEEEESSVSEITTSLSEEVLDLRGAERYQKGVCVPGRALGPPRRRCLPAASGPGVDVSLW
NILRNNIGKDLSKVSMPVQLNEPLNTLQRLCEELEYSSLLDQSRIADPCERMVYIAAFAV
SAYSSTYHRAGCKPFNPVLGETYECERPDRGFRFISEQVSHHPPISACHAESENFVFWQD
MKWKNKFWGKSLEIVPVGTVNVSLPRFGDHFEWNKVTSCIHNILSGQRWIEHYGEVLIRN
TKDSSCHCKITFCKAKYWSSNIHEVQGAVFSRSGRVLHRLFGKWNEGLYRGPLPGGQCIW
KPNSMPPDHERNFGFTQFALELNELTAELKRSLPSTDTRLRPDQRYLEEGNIQAAEAQKR
RIEQLQRDRRRVMEENNIVHQARFFRRQTDGSGKEWWVTNNTYWRLRAEPGYGNLDGAVL
W
Download sequence
Identical sequences G1P6X8
ENSMLUP00000005842 ENSMLUP00000005842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]