SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005858 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005858
Domain Number 1 Region: 158-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000028
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000117
Family Ubiquitin-related 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005858   Gene: ENSMLUG00000006410   Transcript: ENSMLUT00000006413
Sequence length 502
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429817:6242073:6317565:-1 gene:ENSMLUG00000006410 transcript:ENSMLUT00000006413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIFIAFEESFEPFEVSADETVEAVKRMIKDYFYIPLSEDEQGRQYLELMYAGAALENSW
SLADVGISFCSILKCFVKEEDKPTLYVFNAVTQEKMLIMESISLLGKKVSELRTLLSLRC
GFPVSVFCLRTPRGLEMFDCNTLRDYQTDIGTTLRLDVWDGWKEFLMGCLLGQKLKVQRY
LSNEKPVLKYQKRVALYIAAFYGYIELTEWALKQGVRPNEAVGVHPYRAWCHKALHADVS
KCPIHAAAEAGQLLILKAFVNYSVLCLECKNAVGQTPLTIASKHKHKDCVLYLLSKMWST
VSFLKISVPMRIYIKIKQWVLRAQSHNLYKSQLCGARIFGAKVGDPVMVDGFTKPKMTSK
SWHKAGNKDSQNIMCKLPPLREQITSRKRINPLAISQQDTREQTLKCPQLVDTNIFSELQ
RHQQQNWKNMIATVRKKEKLTKNTYLPQIPLPPVSRVGYSHPSFYYATSCTDFIPRSSFK
SFSEHSGRTPRENAIYYLAVAR
Download sequence
Identical sequences G1P6Z1
XP_014311282.1.53796 ENSMLUP00000005858 ENSMLUP00000005858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]