SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005897 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005897
Domain Number 1 Region: 76-151
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-21
Family SH3-domain 0.00063
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000005897
Domain Number - Region: 445-490
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0144
Family Apolipoprotein A-I 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005897   Gene: ENSMLUG00000006453   Transcript: ENSMLUT00000006456
Sequence length 521
Comment pep:novel scaffold:Myoluc2.0:GL429898:158765:166143:-1 gene:ENSMLUG00000006453 transcript:ENSMLUT00000006456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGAPASAVSLTSHPRSPCQLAELPKMVQSELQLQPGAGRRVEVASWGGCGSDKGAGLDNP
GMPSISLDPQQPPKMSSLTCDNPPDYLRTVFYPETYRVLFDYQPEAPDELPLRKGDEVKV
LRKTTEDEGWWEGESQGRRGVFPDNFVLPPPPIKKLLPRKVVLQDSAPVKESKKMMPKTT
LPTVKKLMTAHTGPSKAKPPGGDGQKRPSRDSGSSGSLLAGGPGHTGRKRSRTQATRQRP
ANTQEEERRSRAKAPPANKTATPGKTLTPKKTLPPRKARTPEGVFSADEAPALGVELADE
ALYSKMASSGDEAATLEKALTFDQMLSEETSSGDNTQVDPSPEAAPPKSKSMSSSVHKPE
EHPLDKRDSSDLQLEATPGSLENVVQLWPDPTAFQEKTPVKDETTPKEEAAHKNVAPAQK
NPPPIKPTPGPQGTPTLHSLVPQNPTVSKNDKEEVRKLQEEVESLRKALELMGEQLESKL
MDIWEELKRERERRRLLEVQMNLRIKESLTPSSSPTQQQQT
Download sequence
Identical sequences G1P726
ENSMLUP00000005897 ENSMLUP00000005897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]