SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005948 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005948
Domain Number 1 Region: 615-727
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-25
Family PDZ domain 0.0046
Further Details:      
 
Domain Number 2 Region: 505-593
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-21
Family PDZ domain 0.0077
Further Details:      
 
Domain Number 3 Region: 381-469
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-19
Family PDZ domain 0.012
Further Details:      
 
Domain Number 4 Region: 271-365
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-19
Family PDZ domain 0.027
Further Details:      
 
Domain Number 5 Region: 28-92
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000114
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005948   Gene: ENSMLUG00000006515   Transcript: ENSMLUT00000006513
Sequence length 730
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429894:2921781:3035337:1 gene:ENSMLUG00000006515 transcript:ENSMLUT00000006513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSDPADDPDPSPEPLCVVCGQAHSPEENHFYTYTEDVDDDLICHICLQALLDPLDTPC
GHTYCTVCLTNFLVSKDFCPLDRQPLVLQHCKKSSILVHKLLNKLTVTCPFAEHCAEVLQ
RCDLEHHFQTSCKGASHYGLTKDRKRRSQDGCVDGCASLVATTLFPEVSAAATVALMTDE
PGLDNPAYVSAAEDGQPADSPSDFGRSNRTRARPFERSSIRSRSFKKINRALSVLRRTKS
GSAEANPAEEGGENSESTTPPEVFPRLYHLIPDGEITGIKINRADPNESLSIRLVGGSET
PLVHIIIQHIYRDGVIARDGRLLPGDIILKVNGMDISNVRHNYALRLLRQPCRVLWLTVL
REQKFRSRNNGQALDSCGPRDDSFHVILNKSSPEEQLGIKLVRKVDEPGVFISNVLDGGV
ADRDGQLEENDRVLAINGHDLRYGSPESAAHLIQASERRIHLVVSRQARQQSPDIFQEAG
WSSNGSRSSGPGARSHNPKKPKFTCHEKVVSVRKDPSESLGMTVSGGASHSEWDLPIYVI
SVEPGGVISRDGRIKTGDILLNVNGVELTEVSRNKAVALLKSTSSSMVLKALEVKQCESQ
EEGNSPAALDSNHNMAPSSDWSPSWVMWLELPRYLYNCKDVVLRRSTAGSLGFCIVGGYE
EYNGNKPFFIKSIVEGTPAYNDGRIRCGDILLAVNGRSTSGMIHACLARMLKELKGKITL
TIVSWPGTFL
Download sequence
Identical sequences G1P770
ENSMLUP00000005948 ENSMLUP00000005948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]