SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000005961 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000005961
Domain Number 1 Region: 42-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000101
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 144-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000222
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000005961   Gene: ENSMLUG00000006531   Transcript: ENSMLUT00000006529
Sequence length 206
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429881:12054:102501:1 gene:ENSMLUG00000006531 transcript:ENSMLUT00000006529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFRLFSFALIILNCMDYSHCQGSRWRRSKRASYVSNPTCKGCLSCSKDNGCSRCQQKLF
FFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKVGFYLH
RGRCFDECPDGFAPLDETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKP
AKDTIPCPTIAESRRCKMAMRHCPGG
Download sequence
Identical sequences G1P782
ENSMLUP00000005961 ENSMLUP00000005961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]