SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006051 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006051
Domain Number 1 Region: 125-304
Classification Level Classification E-value
Superfamily PH domain-like 9.57e-57
Family Phosphotyrosine-binding domain (PTB) 0.000000218
Further Details:      
 
Domain Number 2 Region: 470-580
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-26
Family SH2 domain 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006051   Gene: ENSMLUG00000006630   Transcript: ENSMLUT00000006627
Sequence length 587
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430241:132704:272195:1 gene:ENSMLUG00000006630 transcript:ENSMLUT00000006627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRTKYNHFKKDSVTSVDDLLHLSVSGGSKVSAARAAPAAAAPYLVSGDALRRAPDDGS
GSRGHLLHKVSHLKLASSGLRGLSAARERAGARLSGSCSAPSLAAPDGSAPPGPRAPAMR
AARKGRPGEEPPPSAPPASDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGAKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTSDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGAIGQAFELRFK
QYLRCPSKVPALHDRMQSLDEPWTEEEGAGSDHPYYNSIPNKAPPAGGVDARLKARPHGP
DSAPFSGKEQTYYQGRHVGEPFGEDWQQTPARQGSLDTSSMPGGTAPAAPTGEAPTYMNT
PHFPPQAGPAAGSSAESSPRKDLFDMKPFEDALKNQPVGPVLSKAASVECISPVSPRAPD
AKMLEELKAELWYQGQMSRKEAEGLLKRDGDFLVRKSTTNPGSFVLTGMHDGQAKHLLLV
DPEGTIRTRDRIFDSISHLINHHLANRLPIVSAGSELCLQQPVERNP
Download sequence
Identical sequences G1P7F4
ENSMLUP00000006051 ENSMLUP00000006051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]