SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006065 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006065
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.74e-32
Family Single strand DNA-binding domain, SSB 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006065   Gene: ENSMLUG00000006646   Transcript: ENSMLUT00000006642
Sequence length 213
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429886:3276315:3280429:-1 gene:ENSMLUG00000006646 transcript:ENSMLUT00000006642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGN
LIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSAQQA
PNKTVQNDSSPAAPQPTTGPPAVSPEPASESQNGNGLSAPPGPGGGPHPPHAPSHPPSTR
ITRSQPNHTPAGPPGPSNNPVSNGKETRRSSKR
Download sequence
Identical sequences G1P7G6
ENSMLUP00000006065 ENSMLUP00000006065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]