SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006070 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006070
Domain Number 1 Region: 4-271
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.03e-56
Family FCH domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006070   Gene: ENSMLUG00000006628   Transcript: ENSMLUT00000006648
Sequence length 884
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430755:58610:81572:1 gene:ENSMLUG00000006628 transcript:ENSMLUT00000006648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYFGEHFWGEKNHGFEVLYHNMKQGPISTKELAEFIRERATIEETYSKAMAKLSKLASN
GTPVGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYSEEQLKMHKKLKEEAGGT
LDAVQVLAGVSQLLPKSRENYLNRCMDQERLRRESTSQKEMDKAETKTKKAAESLRRSVE
KYNSARADFEQKMLDSALHFQTMEETHLRHMKTLLGSYAHSVEDTHVQIGQVHEEFKQNI
ENISVEMLLRKFAESKGTGREKPGPLDFEAYSAAALQEGNNEASAGASFRLPGLSRFGRG
EPDSPLVLQACAEVDEEGFTVRPDVTQNNILVAPSGGGCYDSDFDDEPRKFYVHIKPAPA
RAPACSPEAAAAQLRATAGSLILPPGPGGTMKRHSSRWDAAGKPQRPRSAPRASSCTEKL
QSDELASKTLFGPPLESAFDHEDFTGSSSLGFTSSPSPFSSSSPENVEDSGLDSPSHAAP
GPFPDSWALRPGTPQSPPTCRPQPPESRGTRPLLSSDSPLPLAASPGPWGREAVAGGDPT
PGPADLPATEGLAAPPRRPRSRKVSCPLVSSNGDLSHSLSSSPLGSSVPGTAPERSSVLL
ADGTRISRGPSPVVLGSQDALPVATVFTEYVHAYFRGHSPSCLARVTGELTMTFPAGIVR
VFSGTPPPPVLSFRLVHTTPIEHFQPNADLLFSDPSQSDPETKDFWLNMTALTEALQRQA
EQNPAASYYNVVLLRYQFSRPGPQSVPLQLSAHWQCEATLTQVSVEYSYRPGATAVPTPL
TNVQILLPVGEPVTNVRLQPAATWNLEEKRFLWKLPDVSEAGGSGHLSASWEPCSGPSTP
SPVAAQFTSEGATLSGVDVELVGSGYRMSLVKRRFATGMYLVSC
Download sequence
Identical sequences G1P7H0
ENSMLUP00000006070 ENSMLUP00000006070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]