SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006092 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006092
Domain Number 1 Region: 325-434
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-32
Family SH2 domain 0.00000489
Further Details:      
 
Domain Number 2 Region: 6-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-29
Family Ras-binding domain, RBD 0.00048
Further Details:      
 
Domain Number 3 Region: 127-241
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000301
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006092   Gene: ENSMLUG00000006653   Transcript: ENSMLUT00000006672
Sequence length 438
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:15691179:15732778:1 gene:ENSMLUG00000006653 transcript:ENSMLUT00000006672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLPTQVIKIYSEDETSRALEVPSDITARDVCQLLILKCHYVDDHCWTLFEHLTLLGLER
IIEDHELVVEVLSNWGMEEENKLYFRKNYAKYEFFKNPMYFFPEHMVSFSTETNGEISPA
LILQMFLSSSTYPEIHGFLHAKEQGKKSWKKTYFLLRRSGLYFSTKGTSKEPRHLQFFSE
FGNSDIYVSLAGKKKHGAPANYGFCFKPNKARGPRDLKMLCAEEEQSRMCWVTAIRLLKY
GMQLYQNYMHPYHGRGGCSSQSISPMRSISENSLVAMDFSGQKSRVIDNPTEALSVAVEE
GLAWRKKACLRLGNHGSPKASSQSSAISMVIHRSQPWFHHRISRDEAQRLIIQQGLVDGV
FLVRDSQSNPRTFVLSMSHAQKIKHFQILPVEDDGQMFHTLDDGHTRFTDLIQLVEFYQL
NKGVLPCKLKHYCAKIAL
Download sequence
Identical sequences G1P7J0
ENSMLUP00000006092 ENSMLUP00000006092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]